SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007854 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007854
Domain Number 1 Region: 10-74
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000158
Family TBP-associated factors, TAFs 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007854
Domain Number - Region: 190-301
Classification Level Classification E-value
Superfamily ARM repeat 0.00109
Family Diap1 N-terninal region-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007854   Gene: ENSGMOG00000007352   Transcript: ENSGMOT00000008083
Sequence length 625
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4201:91168:99371:-1 gene:ENSGMOG00000007352 transcript:ENSGMOT00000008083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADREERRFAEVPRESVKLVAESAGVELSDDVAALLAEDVCYRLREATQSSSQFMRHAKR
RKLTVEDFNRALRWSNVEAICGYGAQDVLPFRSIKEGELFFVEDRDINLVELALATNIPK
GCAETMVRVNVSYLDGKGNLEPQGTVPSAVQTLSDDLLKYYQQITRAILGEDPHLMKVAL
LDLQSNSKMAALLPYFVYVISGVKSVSHDLEQLNRLLHMVKSLIQNPYLYLGSYVRSLVS
SVMYCILEPLAASINPLNDHWTLRDYAALLLSHIFWSHGDLVSGLYHQILLSLQKVLSDP
VXXXXXXXXXXXXXXXXXXXAVERVLYPHLPAYWANLQAVLDDYSVSNAQVKADGHKVYG
AILVAVERLLKMKALSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAPPLPSLPPRTYAHK
LPVIGRVSKPVRRWACSHYSLHLPL
Download sequence
Identical sequences ENSGMOP00000007854 ENSGMOP00000007854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]