SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007880 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000007880
Domain Number - Region: 235-281
Classification Level Classification E-value
Superfamily Plexin repeat 0.000157
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007880   Gene: ENSGMOG00000007370   Transcript: ENSGMOT00000008109
Sequence length 421
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3517:23979:29752:-1 gene:ENSGMOG00000007370 transcript:ENSGMOT00000008109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQHRPEESEPDLLTEEGHDNSSQIVDIDHVYYTSKIYGPGDPGGKALWLDIDQISNADRK
VHGFISNTHRQAAKVNLSFDFPFYGHILKEITVATGGFIYTGDTIHWMLTATQYIAPLMA
NFDPSLSTDSSVSYVDNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISA
QHHPVKMGLSDAFVVLHKLEQIPNVRRRTIYEYHKVDILKSNISNCTAVEILPLPTCVQF
SSCGTCVTSQIGFNCSWCTRLQRCSSGFDRSRQDWVDHGCPEERRDPRCPRPTARPHRPT
NTTTPVSVSSTERHRASATSSPPWLRSPGDRHHHHHGSSGEEQLQTRLLAAIILPMVIIA
TVILLSVYMYNHPTSTASLFLLERRPTRWPVMKFRRGSGNPSYAEVEAPGQKEGFIVPDQ
R
Download sequence
Identical sequences ENSGMOP00000007880 ENSGMOP00000007880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]