SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007883 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007883
Domain Number 1 Region: 140-489,580-601
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.39e-79
Family Myotubularin-like phosphatases 0.0000118
Further Details:      
 
Domain Number 2 Region: 14-117
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000897
Family GRAM domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007883   Gene: ENSGMOG00000007368   Transcript: ENSGMOT00000008112
Sequence length 759
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2525:873852:892744:1 gene:ENSGMOG00000007368 transcript:ENSGMOT00000008112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRKKLTAREGGGWLAGTLFCTHFRVSFVPQDNADPVLLGEHDVALASIEKVVAVGPSRT
KLVTPNSSLKFTPEELVLYCRDLRVICFLFDRLTPDTQAVEITYTIAKTYQPLKPGCVLA
FQNAALGSVGNRRRDGQMNWFESVDEWERELERCGAKGWRVSTVNDRFEMSTSLPRYNVV
PQRVLDTELKRTFAHFNEGRIPRWSWRHPRGSDLLRMSSFQNNIYHEKDDTRNLELVLFG
SQWSLCVVVDLGEEMPSPADLHLAHSRLRALCLGDISNSVTVPDDKWLSTLESTHWLDYT
RCCLRKAGEVACLLRGGHMTVALQESEDRDMGCLVSSLVQVMCDPHCRTQEGFQGLVQKE
WVMSGHRFYSRLNYHRDNDKEEAPVFLLFLDCVWQLWSQFPSRFQLTDHFLLALYDSTHL
PLFSSFLANCQRERCKRTQQHLTQTYTPVNGWRDVLSPTDSVDPPLPSVWDWALQYGGGR
LSRFTQPVPPTPPTPPMSDTVQGSVFLLSRGSFSSPTNLLPWRGGGAAVYKRSHRRAPSS
ESLSGLERLLKATALTDAPQGLTSTSASTTGPQGSPLDHYEPLLPLLLGPCMRVWKECYL
RGVLHAQAFSHPVSSNHAHPVVRLALEVQQLHEQLALASASTAPAPPPPPPRHRRPDANL
NQNTNNGTFLFPAPRAQARPVPPAPTSSSSSANPKTSRVPPPPPLPPPPRLQDHPSAGGS
AKHTFLFGPPASSSQDPRAEPRYYPNAKLPHGNRPTIGS
Download sequence
Identical sequences ENSGMOP00000007883 ENSGMOP00000007883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]