SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007903 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007903
Domain Number 1 Region: 321-493,932-1080
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.82e-123
Family Mammalian PLC 0.00000817
Further Details:      
 
Domain Number 2 Region: 641-755
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-30
Family SH2 domain 0.00000314
Further Details:      
 
Domain Number 3 Region: 543-659
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-25
Family SH2 domain 0.00044
Further Details:      
 
Domain Number 4 Region: 788-855
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-21
Family SH3-domain 0.0000719
Further Details:      
 
Domain Number 5 Region: 486-526,870-929
Classification Level Classification E-value
Superfamily PH domain-like 0.000000122
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007903   Gene: ENSGMOG00000007363   Transcript: ENSGMOT00000008133
Sequence length 1128
Comment pep:novel genescaffold:gadMor1:GeneScaffold_369:1441:23170:-1 gene:ENSGMOG00000007363 transcript:ENSGMOT00000008133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTPGFFSNGAGPWTENDAETNSLYRDLELGTVLTLFYSKKSQRPERRTFLVKLETRTI
VWTRGTDKIEGEIYLYNIYLCYIYIWLYGPSLMRYYKYGSTPPLSLSLGIIFYVPWFYGH
MISCQTLDTAGETIRGWTAHLSFLIQNLIRSITSVSRSQGDVSFHIFQTSRQTKPGPSWI
SEVLGKVSFKYTLEKFIHLSLHCTRLQLLLKRKNYLPVVVFSIFDKLHTEVKEFYLLGTT
LEEDTFVDVLLYNLTEFMLGNCMLRPLRLIHQEFNLPSIRHAILMMQTPQLSGGKFLTYL
FSKENTIWDASLDTVCPDDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYSRCLRLGCR
CIELDCWDGPEGMPVIYHGHTLTTKIKFCDVLATIKEHAFVTSEYPIILSIEDHCSIVQQ
RNMATNFKKVFGDMLLTKTVDISADGLPSPNQLKRKILIKHKKLAEGSASEEVPTSTPYS
ENDISNSIKNGILFLEDPVNHEWYSHFFVLTNTKIYYSEETTSNQGNEDEEEHREVTNGM
DQHVTEKWFHGKLGAGRDGRQIAERLLSEYCLETGAPDGSFLVRESETFVGDYTLSFWRS
GRVQHCRIHSRQEAGSPKFYLTDNLVFDTLFALITHYQQVALRCNEFEMKLTEPVPQTNA
HESKEWYHANLSRSHAENMLMRVPRDGAFLVRKRTEPNSFAISFRAEGKIKHCRVQQEGQ
IVVLGTSEFDNLVDLISYYEKHPLYRKMKLRYPINEDTLEKIGTAEPDYGSLYEGRNPGF
YVEANQMPTFKCTVRAMYEYKAQRDDELSFIKNATISNVDKQEGGWWKGDCGGKKQLWFP
ANYVEEISPSAAEPDRGEMTENSPLGDLLRGSVDVSSCQIGRRRRRRGSRPHVFSLVPAS
SPRAGQVVDIAASSSEELKEWVAKIREVTMTSEAKLEEGKMMERRKKIAQELSDLVVYCR
PVPFDEDKIGRERACFRDMSSFPETKAEKYVNKIKGKKFLQYNRLQLSRIYPRGQRLDSS
NYDPLPMWLCGSQLVALNFQTADKPMQMNQALFMLNGRSGYVLQPPIMRDETFDPFDRHT
LRGLEAVTLEIEVLGARHLPKHGRGIVCPLIEIEVCGAEYDSAKLKTE
Download sequence
Identical sequences ENSGMOP00000007903 ENSGMOP00000007903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]