SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007909 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007909
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.95e-43
Family Calponin-homology domain, CH-domain 0.000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007909   Gene: ENSGMOG00000007402   Transcript: ENSGMOT00000008139
Sequence length 198
Comment pep:novel genescaffold:gadMor1:GeneScaffold_755:1111:2774:1 gene:ENSGMOG00000007402 transcript:ENSGMOT00000008139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRGPTYGLSREVQEKIDQKYDPDLEQRLVDWIVGQCGGNLERPQAGKHNFQAWLMDGT
ILCRLINSLYPRGKEPIKKILETQMAFKQMEKISNFLQATEAYGVITTDIFQTVDLWEGK
DLAAVQRTLMALGSVAVTKDDGHYRGDRDWFHRKAQGYRREFTEEQLRQGQSLIGLQMGS
NRGASQSGMTGYGMHRQI
Download sequence
Identical sequences ENSGMOP00000007909 ENSGMOP00000007909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]