SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007927 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007927
Domain Number 1 Region: 255-347
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-16
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 85-146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 171-235
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000981
Family Carboxypeptidase regulatory domain 0.08
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007927
Domain Number - Region: 439-490
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00249
Family Carboxypeptidase regulatory domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007927   Gene: ENSGMOG00000007417   Transcript: ENSGMOT00000008157
Sequence length 1127
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1983:82379:92383:-1 gene:ENSGMOG00000007417 transcript:ENSGMOT00000008157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWTSWFNIDHPGGNGDYERLEAIRFYYRERVCTRPSAMEARTTDWVAAAETGEVVHSSLE
KGFWCVNKEQPYGRTCSNYHVRFHCPPGAYWTDWSEWGSCSTGACGDVGVQVRQRRCVSN
QPVPLLLVPACQGPHSERRECSTAPCTDKCLMVCPEGLPSADCGRCLCEGHVLQGEVYTI
TGVPVAGATVALADRPKVALAQSDPAGRFRVPGVCSSSPSLLSVRKERFAAAAVSTSSNA
TGLSWVRAVLGSTEKPYISKHPENKVRHEGGRVLLCCKATGSPTPDKYYWYHNGTLLDRN
VFKYEEDLVLRDLKPRQAGLYHCKASSPAGSIKSTQAFLTVIGRGTPACNPTPEDNNIRL
PMDCVQPGTDSKNYNAGRCPHNTCAGSLDSDLRCRDGAGYCCGVQEMETRTIDCGKYSLP
IRAVTQCGCKKCVQPSVMVRGRVVSADNGEPLRFGHIYIGKERVSTTGYQGGFTLHIAQD
TARLVVNFVDPSEKFIDTPKVFIFDKRGGSIYHDVKVMRKQAAISINAGETNTIELGEIK
GEDPIGQIVIPPNSFHRENGELYEGTVKASVTFIDPRNITTAAAAPGDLNFVDDEGDMLP
LRTYGMFSVDFRDEFNKEALGTGAVQVLLDTQHVKMEEHIPKMKLWSLNTETGVWEEESD
FSYTRATGSHGRVKREERTFLIGNMEIRERRLFNLDVPENRRCYVKVRAYMSEKFLASEQ
VEGVVISLINLEPKPGFSSNPRAWGRFDSVITGHNGACLPAFCDAQRPDAYTAYVTAIMG
GEELEAAPSSPKMNPNIIGVSQPYLNKIDYQRSDHNDPALKKTAFRINLAKPNPNNLQEA
NGPIYPYRNLIACENAEINDNHFRFFRVEKDKYEYNVVPFQENDLTTWTGDYLSWWPNPQ
EFRACFIKIKVQGQKEVMVRSKNMGGTHRATKGKLYGIRDIRSTRDMREANTSAACVEFK
CSGMLFDQSEVDRSLISLLPQGNCRRVGINNLLQEYLTKHPPVPQNNESHAFHMLAPVDP
LGHNYGIYTVTDQNPRVAKEIAIGRCFDGTSDGFSREMKSDSGVAMTFSCPERKITRESL
FQRLQTNPGQTLSQMARDMRESQGLQVQRSSTQVVAYPSEQRSRSQG
Download sequence
Identical sequences ENSGMOP00000007927 ENSGMOP00000007927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]