SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007958 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007958
Domain Number 1 Region: 145-253
Classification Level Classification E-value
Superfamily Second domain of FERM 9.29e-22
Family Second domain of FERM 0.0014
Further Details:      
 
Domain Number 2 Region: 58-144
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-20
Family First domain of FERM 0.0019
Further Details:      
 
Domain Number 3 Region: 255-405
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000004
Family Third domain of FERM 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007958   Gene: ENSGMOG00000007429   Transcript: ENSGMOT00000008188
Sequence length 1003
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3655:1214282:1242928:1 gene:ENSGMOG00000007429 transcript:ENSGMOT00000008188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAVRIIVGVEDLVASSGQLAWSLAQQSLKRWYQRGVVVPCRQLMDAWLQVGGCYQMTEGR
LCQIHLLDDRNLELLVQPKLLSRELLDLVSSHFNLKEKEYFGLSFIDDTGQNNWLQFERR
VLDHDFNKKSGPLELRFLVRFYIEKITFLKDNTTVELFYLNAKSAVCNETIEVESEHVFK
LAALALQEAKGEHTSSETAREDLKQLTLLPTRVLREHPSLTYCEDRVIEHYKKLQGVSRG
GAIVQYLALVESLPTYGVHYYPVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFQWKQL
ENLYFREKKFAVEVNDPHRRTVTKRTFGQAGLVIHTWYASHSLIKTIWGMAISQHQFYLD
RKQSKAKLTATRSSGDIAMDLTEISVPRIRKMTSTETRDQLIMASNGSLISAGSVDSEII
EERKKEKISDLKKKEKDLEDKLAKKMEELKNVCMREAELTGQLPKEYPLGAGEKAPPIRR
RVGTAFKLEDPSLYDKDPHLRNLESRFELQQKFVEASMKLASEEDLAKTVKKKRKNNYLD
AMRMLQNMEDEINAYRKTMGQKPTQRASLIMAEDSNPSELSSLSDSLTLDDDDELGSQRL
RSRSVQYSPRPHHADTLDIHYGQDRGLEQPLDNSNHGALSGHSSPYRPPPRQPRDARSMP
PTPVLPRNAFSSTQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRRKELYANTGSMPNLAQHHAQPEARAPAY
QPRPRPTTTAYYVTGYPSYPEPEPFYNNGGYAYDSNEMEGHYSVNPSPHQPHHGYDAIDE
LDGASNLYATLRPSRSRPSPHSSKHAAQKTVHKALVAEHLRGWYQRNTGVKQPEYDCEYD
RGSQQSLGYQTMPAPYARSYSPTASCAGNWQGNMGGSMGQYDVHAHQAYSCSTTTAHYSQ
PTHSRSYIDVHQLDTHAGSPLGAPRPEDHLQWHETSGKPGTIV
Download sequence
Identical sequences ENSGMOP00000007958 ENSGMOP00000007958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]