SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008071 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008071
Domain Number 1 Region: 17-116
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-17
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 194-259
Classification Level Classification E-value
Superfamily PH domain-like 5.27e-16
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008071   Gene: ENSGMOG00000007540   Transcript: ENSGMOT00000008302
Sequence length 273
Comment pep:novel genescaffold:gadMor1:GeneScaffold_168:65049:69288:-1 gene:ENSGMOG00000007540 transcript:ENSGMOT00000008302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSNIPPDESSLIDDSGSQWSASLDTEEDRRAALEKSIYVLTELLDTEKLYVEDLRLIVE
GTMATQGVPEDLKGKDKIVFGNIHQIYDWHKDYLLGELEKCFDDPERLANLFIKHXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGKITAQGKLLQQDTFSVSEQENNILSRGRERRVFLFEQLVIFSEPID
KKKGFSLPGYTFKSSIKXXXXXXXEKQQAWLSD
Download sequence
Identical sequences ENSGMOP00000008071 ENSGMOP00000008071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]