SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008088 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008088
Domain Number 1 Region: 57-528
Classification Level Classification E-value
Superfamily Sema domain 4.97e-130
Family Sema domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 1374-1501,1697-1763
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.84e-27
Family p120GAP domain-like 0.035
Further Details:      
 
Domain Number 3 Region: 979-1060
Classification Level Classification E-value
Superfamily E set domains 1.52e-16
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 878-973
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000546
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 531-582
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000034
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1061-1164
Classification Level Classification E-value
Superfamily E set domains 0.000000137
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.041
Further Details:      
 
Domain Number 7 Region: 827-861
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000301
Family Plexin repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1168-1243
Classification Level Classification E-value
Superfamily E set domains 0.000007
Family E-set domains of sugar-utilizing enzymes 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008088   Gene: ENSGMOG00000007543   Transcript: ENSGMOT00000008319
Sequence length 1916
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1600:552485:718599:1 gene:ENSGMOG00000007543 transcript:ENSGMOT00000008319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDHINRSLAGPVSMEDRRNTHRTSLARPTVGTLAALLGCCCCWLLAVPTSCNGQTFTTFH
PERKEWAFNHLTVHQNTGALYLGAVNRVYKLSGNLTLLVSHDTGPEDDNKACYPPLIVQP
CSEPLVATNNVNKLLLVDYSQNRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSV
NQTGTMYGVIVPSQGQDGTLFIGTAVDGKQDYFPTISSRKLPRDPESSAMLDYELHTDFV
SSLIKIPSDTLALVSHFDIYYVYGFASGNFVYFLTVQPETPENSMSSGGSSSDLFYTSRI
VRLCKDDRKFHSYVSLPVGCVKNGVEYRLLQAAYLGKPGRVLAASLNISAQDDVLFTVFA
KGQKQFHRPPDDSALCVFSIRDINARIKERLQSCYQGEGHLELNWLLGKDVQCTKAPVPI
DDSFCGLDINQPLGGSQLVTGHTLYTESRDRMTSVTAYVYNGYCVAFVGTKSGRLKKIRV
DGPPHGGVQYETISVIKDGSPVLRDMAFSLDRNYLYVMSERQVTQVPIESCEQYGTCGEC
LSSGDPHCGWCVLHNMCSQRSRCERADEPYRFAAALSQCVRATVYPDSIAVSEPSVPLLV
RVSDVPDLSAGISCSFGNLTESEGKVSGNQILCVSPSAKDVPAIPADQDWSGVELRLNSK
ETGQMLISTEVKFYNCSVHQLCLSCVNSAFRCHWCKYRNLCTHDPSSCSFQEGRVNASED
CPQLVRSEDILIPAGEVKPITLKARNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSV
QCQNSSYLYEGMKISELPVDFSVVWNGNFIIDNPENIQVHLYKCAAQRDSCGMCLKAERK
FQCGWCSGEGRCTLRHHCPPMNPYTTRWLHLASRNVKCTNPRITEVTPVAGPPEGGTRVT
IHGMNLGLSFADMVGNVEVAGVRCVPVEEGYIIAEQIVCEMDPAPPESRPGPIQLCVGEC
RPELKTRSSQLYSFVMPSVTGLTPSRGPESGGTKVTILGDNLGAGSNVSVQFGNQTCEFY
GRTMTEIVCYSAPSQAGVGPVQISVSVDRAQVRESLSFEYIEDPTVARIEPEWSIASGHT
PLMVTGTNLDVVQEPRIRVKYGGRESVNXXXXXXXXXXXXXXXXXXXXXXXXPDTVKHAD
EFGFVFNNVQALLVYNSTSFLYYPNPYFEPLSSTGVLEQKPGSPIILKGRNLVPPATGGV
KLNYTVLIGDTPCSVTLSESQLLCEPPNLTGQYKVMVQVGGLHVSPGAVNILSDSLLTLP
AIVSIAAGGGLLLIIVILVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQ
TDINELTSDLDRAGIPHLDYRTYAMRVLFPGIEDHPVLRELEVSGTGQQAVEKALKLFGQ
LINNKVFLLTFIRTLEMQRSFSMRDRNVASLIMTALQGRLEYATDVLKHLLSDLIDRNLE
SKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAIT
GEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYK
NMPYSLRPRAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLMHYQVSDRCVVALV
PKQTSSYNIPPSASISRSSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNH
EHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLAIKYMFD
FLDEQADKHGIHDTDVRHTWKSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXITAALEQDEQARKQRLASKVGQLIAAMSKDS
Download sequence
Identical sequences ENSGMOP00000008088 ENSGMOP00000008088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]