SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008136 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008136
Domain Number 1 Region: 178-383
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.98e-37
Family DBL homology domain (DH-domain) 0.000000971
Further Details:      
 
Domain Number 2 Region: 2-210
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.14e-34
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 
Domain Number 3 Region: 373-536
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-28
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 741-804
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-21
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 5 Region: 640-737
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-20
Family SH2 domain 0.0008
Further Details:      
 
Domain Number 6 Region: 575-642
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000302
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008136   Gene: ENSGMOG00000007593   Transcript: ENSGMOT00000008369
Sequence length 808
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4029:34510:52463:1 gene:ENSGMOG00000007593 transcript:ENSGMOT00000008369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMWRQCATWLVECRVLPESHRATWEGAQVCELAQALRDGVLLCQLLNNLLPHSVNLKEI
NLRPLMSQFLCLKNIRTFLGACQEKFNLRKSELFEAFDLFDVRNFAKVLDTLSLLSRSFI
AIQKGYQPFPHHGCTADDDTYSSLSDQIDDTAEEDDDLYDFVEDDDNEGDEIYEDLMRTP
PQKKVDKRECCLQEIRQTEEKYSATLQSILLHFVKPLQKFLQPQDIESIFINMPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLLYGRYCSLVESASKHLEKISSTREDVKMK
LEECSKRANSGRFSLRDLLMVPIQRVLKYHLLLQELVKHTPDPTAKDNLRAALDAMKDLA
QSVNEVKRDNDIIRQITTFQLSIDNMTQSLALFGRPKIDGELKICSTEKKSKQDRYAFLF
DKAMFVCKKKSGDMFELKEIIELQNYQLRDEASGEKDNKKWSHVFLLLESFGKCGYDLFF
KTKELKKKWLEQFEMALSNMCPENCNSNNHDFQMHCFEETASCNACSMLLRGIFFQGYCC
SHCKMAAHKECLGRVPVCGRRXXXXXXXXXXLFYSSGLPKVEVIQDYCGMPPAPAGFGQQ
LHLTKGDVLELKKADVDFTWWEGRNVTTGQMGWFPSKKVHPFSSFAGNMDRTAAKNLLSA
RSDGTFLVRQKDAGEYAISIKFDPEIRHIKITSLEGLFRINERKAFKGLIEMIQFYEQNS
LIECFKDLDTTLLTPYKQAERVDNQPVGMVRARYDFSARDRKELSLREGDTIKIISKKGP
SGWWKGEVYGRVGLFPANYVDEDHSEYC
Download sequence
Identical sequences ENSGMOP00000008136 ENSGMOP00000008136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]