SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008154 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008154
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily Fibronectin type III 2.95e-18
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008154
Domain Number - Region: 317-382
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00022
Family Fibronectin type III 0.0083
Further Details:      
 
Domain Number - Region: 218-274
Classification Level Classification E-value
Superfamily Viral chemokine binding protein m3 0.0118
Family Viral chemokine binding protein m3 0.012
Further Details:      
 
Domain Number - Region: 392-455
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0162
Family Fibronectin type III 0.0088
Further Details:      
 
Domain Number - Region: 12-84
Classification Level Classification E-value
Superfamily Immunoglobulin 0.033
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008154   Gene: ENSGMOG00000007619   Transcript: ENSGMOT00000008387
Sequence length 457
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2819:126387:133957:-1 gene:ENSGMOG00000007619 transcript:ENSGMOT00000008387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFLTVVPAQEFILGSDLTVYCHLTEKCSSSIHLILWLDKVTVEPEQRINCTTARFRLTNL
RTPEPVVKCLMRMEGRSYAVTGLRLHGGLPPDKPTDVYCETSRDSGVLDCRWDQGQKTYL
STSYNISLSSENGTQIHSVHEQRANCQVPKTLLDENENYQLTITSYNTKGTSKSEPFNFC
VKDVGAAETCINYSVLFRRHPDLSLTHKGKQSLNRCLSFDLPVSCSNNSQSYIISVSCSN
NGQSYISPILPIPFYLGIDSGRIVQAYVIQEHSTVCRKRLSRLSEVNVSVLCWRASGPSL
KLQVWRILGHHDDSGLQNVTVLWKPSPQEDYSGTLRRYEVRAASKTDICLPDLSLCVVQV
SPDVHTLWVSAVTSYGRSPPAAVQLIPSGTVPQRATARTLRDGHGSVVLSWSWPPPGPGG
SGGTGELVSYVTEWTIRPAELRWNILSRDQNTTLIGG
Download sequence
Identical sequences ENSGMOP00000008154 ENSGMOP00000008154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]