SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008156 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008156
Domain Number 1 Region: 117-279
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 3.14e-24
Family Nuclease 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008156   Gene: ENSGMOG00000007616   Transcript: ENSGMOT00000008389
Sequence length 282
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3340:167874:173346:-1 gene:ENSGMOG00000007616 transcript:ENSGMOT00000008389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSLSCVSSLKEDVKPCFIQPHYKESYRLAIYALLCGGTEAYDEFLKAEQISHFLSDEE
ILYVLENAELPVSEDGGSGKTKEREESHPSTYFPTESDEQVPDLDLGWPEVSSTSETNIS
LLFHPPRQNTPTIKEVVRKQILDAKQLIAISMDVFTDVDIFQELVSASRRGVIVYILLDH
TQFHAFLHMSQRLGVNIKDLQNLRVRTVSGPQYQCQSGAKFSGALEQRFILVDCRTVLYG
TYSYTWSFEKINLSMVLVVTGQLVGSYDEEFRRLYARSVAPT
Download sequence
Identical sequences ENSGMOP00000008156 ENSGMOP00000008156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]