SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008210 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008210
Domain Number 1 Region: 15-227
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-41
Family DBL homology domain (DH-domain) 0.00097
Further Details:      
 
Domain Number 2 Region: 212-330
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-22
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 3 Region: 391-513
Classification Level Classification E-value
Superfamily PH domain-like 7.45e-17
Family Pleckstrin-homology domain (PH domain) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008210   Gene: ENSGMOG00000007673   Transcript: ENSGMOT00000008444
Sequence length 517
Comment pep:novel genescaffold:gadMor1:GeneScaffold_168:216147:231568:1 gene:ENSGMOG00000007673 transcript:ENSGMOT00000008444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADGNYDRPVCTPDGRSRAFYIAKELMDTERLHVKALKQLQEDFREAVCSAVGADGERVLG
DERLREILTDLPDVYSLHRRILGELEDRLRHWEESQSIADVILSKKADFFVFTTFIGHYD
RSVSLLEDSCRSSPAFAALVSQFEQQSVACEGVSLKHQLLRVIVRVAQYRMLLTDYLNNL
RPDSKEYEDSQAAVAVVSDIADQANDSLQNGENVLRLVNIEYSVRGQKDLLRPGRVFIKE
GTLMKVSRKSSQPRHLFLMNDVLLYTYPQQDGKYRLKDTLSLSGMKVTKPSSEETHNGLK
IEVQDVSISLSASSSSERDDWFYTLSRTVADHSRGAPASTAGHGEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVCRSCSRNRCALKYLKGRTAKVCDHCYS
QLHARGGAVWEEGAISGSLQRSKRSKQHWKRLWFLLKDKVLYTYRAQEEKVASESLPLLG
FTVKLADRAADEANLFQLYHKKTLYYSFRAEDNCTAQ
Download sequence
Identical sequences ENSGMOP00000008210 ENSGMOP00000008210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]