SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008214 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008214
Domain Number 1 Region: 1482-1726
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.22e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 1159-1318,1356-1433
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 109-252,296-373
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.36e-28
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 485-600
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000165
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008214
Domain Number - Region: 1738-1813
Classification Level Classification E-value
Superfamily EF-hand 0.0218
Family Calmodulin-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008214   Gene: ENSGMOG00000007660   Transcript: ENSGMOT00000008448
Sequence length 1983
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2465:7055:101310:1 gene:ENSGMOG00000007660 transcript:ENSGMOT00000008448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGDDAPARYGGGPGGGGPGGRGGSRQGGPHGHGHGHGHGHGAPGGPGGQRVYKQSMA
QRARTMALYNPIPVRQNCFTVNRSLFIFSEDNFXXXXXXXXXXXXXXXXWMILGTIIANC
IVLALEQHLPDDDKTPLSERLDDTEPYFIGIFCFESGIKILALGFAFHKNSYLRNGWNVM
DFVVVCTGILSTVGSDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLL
LFFAILMFAIIGLEFYMGKFHTACFDNYTKDVREEFPCGLEAPSRLCPEGTTCRQYWLGP
NYGITQFDNILFAILTVFQCITMEGWTELLYYSDDASGSAWNWMYFVPLIIIGSFFMLNL
VLGVLSGEFAKERERVENRSEFLKLRRQQQIERELNGYLEWICKAEEVILADDENDGEYD
GSRRRATKNHKNKAELLNPEELDGDLAVGSPFARASLKSSKLEGTTFDRRERRLRFFIRH
VVKTQTFYWTVLCLVGLNTLCVAVVHYDQPEPLSDFLYFAEFIFLGIFLSEMFIKMYGLG
KQAYLNSSFNTFDCIVICGSIFEVLWSIIQPGTSFGISVLRALRLLRIFKVTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNFENGTPPTNFDTFPAAIMTVF
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLLNVFLAIAVDNLANAQE
LTKDEQEEERASKKAALQKAKEVAEVSPLSAANLSIAAKDQKNNLKGLNKSVWEQRTKEL
RKQTLASSREALYNELDPDDRWKARDGVSEEPNNVNFSRNVRPDANTHLDRPLVVNPLEN
RNNNTNKTTQRHPALCRQTQLHRERTDGAEGGGGGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGQAEHRKPTRAHRRSTEEEEGGGGGGGAGGTPQCKETE
GGVEGGDQEGAEEGGERRPRRGRHGNQADGEGKRARQHRRREGSGPSLSTTRPIQKTLSR
QDSQCVEDMDNLMNTRLVSSSQPGQSFGSALYLANSAAGSVVGLDGYGNVTHRRGNSMVR
LPRPDYTALDMPAFPSTNAILQVNKNANTEPLPKKEDKDDDEDEKGGDGGPKPMPPFSSM
FIMSTTNPFRRLCHYVCTLRYFEMCILLVIAMSSIALAAEDPVWPESPRNNVLRYFDYVF
TGVFTFEMLIKMVDLGLVLHQGSYFRDLWNILDFIVVSGALVAFAFTGSSAGKDISTIKS
LRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYMLFMFIFAVVAVQLFKGRFF
FCTDESKEFERDCRGEYLVYEPNNEVKAQKREWKKYDFHYDNVAWALLTLFTVSTGEGWP
QVLKHSVDATYENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMME
DYSLEKNERACIDFAINARPLTRHMPQNKQSFQYRMWEFVVSPPFEYTIMAMIALNTVVL
MMKXDGASVTYEAVLANLNIVFTSLFSMECVLKIIAFGVLNYFKDAWNIFDCVTVVGSIT
DILVTELGNNFINLSFLRLFRAARLIKLLRQGETIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQLFGNIGIEEESESAINQHNNFRTFFLALILLFRSATGEAWHEIMLACLSNK
PCDKLSATVGHECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHL
DEYVRIWAEYDPAACGRISVRDMYDMLRHMCPPLGLGRRCPARVAYKRLLRMDLPVADDN
TVHFNSTLMALIRTALDIKIAKGAEGGVDKHQMDAELRKEMIAIWPNLSQKTLDLLVTPH
KSATDLTVGKIYAAMMIMEYYRQSKIKRSQALRDEQNRTPLLFQPVEAPTPTQDGGPGLA
ALSPSQTTDQPIGSLAVEGGIPESQSWVTARAQEMSQKVGSWSPEGHPGVHSQDGLGRMT
NSQ
Download sequence
Identical sequences ENSGMOP00000008214 ENSGMOP00000008214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]