SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008239 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008239
Domain Number 1 Region: 57-229
Classification Level Classification E-value
Superfamily EF-hand 1.47e-38
Family Calmodulin-like 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008239   Gene: ENSGMOG00000007703   Transcript: ENSGMOT00000008473
Sequence length 233
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2269:163972:233008:-1 gene:ENSGMOG00000007703 transcript:ENSGMOT00000008473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTAVWETEGLQTVGIVVLVCASIKLLHLLGIIDFSEDSVEDELEQSAVRHRPEGLEQLE
AQTRFSRKELQILYRGFKNXXXXXXXXXXXXXXXXXXXXXXXXASTYAHFLFNAFDTDHN
GSVSFEDFVMGLSILLRGTITEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTY
PVLKEETPHQHVEIFFQKMDKNKDGVVTIDEFIDCCQNDDNIMRSMHLFENVI
Download sequence
Identical sequences ENSGMOP00000008239 ENSGMOP00000008239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]