SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008249 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000008249
Domain Number - Region: 137-182
Classification Level Classification E-value
Superfamily EF-hand 0.0168
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008249   Gene: ENSGMOG00000007713   Transcript: ENSGMOT00000008483
Sequence length 409
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2825:256041:258296:1 gene:ENSGMOG00000007713 transcript:ENSGMOT00000008483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRTSYLRMQYLFFSWLAVFVGSWIVYVEYSSYTELCRGQECKTSLCDKYSKGVIDGTACV
SLCQKETLYLGKCLSPKPNSQVYSGTWGDLEGVIRFQMETSPRYALGLAAEVRREPGAAF
NQPTRGTSVERFKEMVISHLKKLGDQANLSALSDMLLSVADSNKDGHITLAEARSVWALL
QHNHFLLAAVLQEREHAPRLLGFCGDLYVMEKVPHAPLYGLSLPWLLEPLVPAGLRRRMD
QWFTPSWPRRAKISMGLLELVEDLFHGTFGSFFMCDVSAASFGYNDRHELRVTDARHIVP
ELAFKEGMQERRCDSDRDCRHGVDCRTSCDLPKGRCSPAVTRPNLAKACDVLKDYILRGA
PDDLREELEKQLYACIALRGAAELLEIEHSLILNNLKTLLWKTISHTND
Download sequence
Identical sequences ENSGMOP00000008249 ENSGMOP00000008249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]