SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008265 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008265
Domain Number 1 Region: 469-547
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.78e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000128
Further Details:      
 
Domain Number 2 Region: 267-306
Classification Level Classification E-value
Superfamily WW domain 0.00000126
Family WW domain 0.005
Further Details:      
 
Domain Number 3 Region: 583-652
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000281
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008265   Gene: ENSGMOG00000007715   Transcript: ENSGMOT00000008500
Sequence length 739
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2538:806560:813398:-1 gene:ENSGMOG00000007715 transcript:ENSGMOT00000008500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIDDILPPLPLEPPALPDEDRAPPPPPLQTSSDADVMDVSSGGDGYTHTPAGPGEDKCP
HQQPHQLSLTFCSQLSDEASASQPCPRTARHAPPVTNFLPDLKLLRDVKIRVSFTDNSTS
KDRKVLFTGLETPGSCPMNGELHDVRQVGMGQDDEAELDQENKVEFAVLDELDDFCDNFL
DPDDVKIGFTSDVIAQQDRGEQEALGYSYEEEFDQDVDALLEEGLPVAKKRRLAEDKFAG
DSDHASDGEEGGVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGIPVYLHRETRVVT
WSRPYFLGTGSIRKHDPPTSSIPCLHYKKMKIHEEKELNGEVSPIAEVSPNEKVSSNAEV
SPAMTTDEATDDALSNKSAMGGQGALGQVTAKVEVCKDESIGLEDFRVYLGKCFDFEQVT
VKKFRTWAERRQFNRDMKRKQAESERPILPANQKLITLSVQDTPTKKEFVINPNGKSEVC
ILHEYMQRVLKVRPVYNFFECENPSEPFGASVIIDGVTYGTGTASSKKLAKNKAARATLE
ILIPDFVKQTSEEKPVEGDELEYFNHISIEDSRVYELTNKAGLLSPYQILHECLKRNHGM
GDTSIKFEVIPGKNQKSEYVMTCGKHTVRGWCKNKRVGKQLASQKILQMLHPHVKNWGSL
LRMYGRESNKMVKKENSDKSVIELQQYARKNKPNLHILNKLQEEMTKLAKEREETRKKPK
MTIMESAQPGSQPLCTVDV
Download sequence
Identical sequences ENSGMOP00000008265 ENSGMOP00000008265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]