SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008407 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008407
Domain Number 1 Region: 339-443
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-29
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 32-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.58e-27
Family Ras-binding domain, RBD 0.00018
Further Details:      
 
Domain Number 3 Region: 160-275
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000411
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008407   Gene: ENSGMOG00000007862   Transcript: ENSGMOT00000008645
Sequence length 447
Comment pep:novel genescaffold:gadMor1:GeneScaffold_671:21046:38259:1 gene:ENSGMOG00000007862 transcript:ENSGMOT00000008645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGGPPPSTIPNPFPELCSPPQSSVVIGSVPPSASDKHLIRVFGEDSYSRSLWVSRGAT
AKEVCHLLVQTAHCSDQESWALIEFHPSRGLERCLEDHEMVLQVQTSWSIKADAKLLFRK
NYAKYEFFRLFFPEAMISDSADASHGIKSSELIETLLRSGSCPEIQGFLQVKEPSRRAWK
RVYFLLRRSGLYSSTKGSSKEPRHLQCVADLGQLSVFQVVNGRRLYGAPSNYTFCIKPAR
EPVHTRGLKLLCAETEEARTCWTSAFRLFKYGKQLHSNFQFSKSDASLVAMDFSGSAGRV
ISASEAKSVEREEGQSWRXXXXXXXXXXXXXXXXXXXXAIHRGHPWFHGGVSRREAERLV
EEQGLVDGMFLIRDSQQQALCFVLSLCHKLKTKHYLVIPCEEGGRQYYSMDDGVTVFADL
LQLVEFHQINRGILPVCLKHPCVGVAL
Download sequence
Identical sequences ENSGMOP00000008407 ENSGMOP00000008407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]