SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008421 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008421
Domain Number 1 Region: 143-332
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-61
Family Phosphotyrosine-binding domain (PTB) 0.0000000234
Further Details:      
 
Domain Number 2 Region: 493-593
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-25
Family SH2 domain 0.00000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008421   Gene: ENSGMOG00000007874   Transcript: ENSGMOT00000008659
Sequence length 600
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2326:80584:92840:1 gene:ENSGMOG00000007874 transcript:ENSGMOT00000008659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVPKTKYTFFRSESLSSTDETNSNPSSLPPSTPPTPFTPSPGLPSSFSSSSLTPILPP
SSPRPAENSPTTLCSFFPRMGSLRLGVSATLLPGDERGSTGSXXXXXXXXXXXXXXXXXX
XXXLQDMNRLGGASRRARVEGGQLGGDEWTRHGSFVNKPTRGWLHSDSVVSTAGVSYSVR
YMGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGAKGAQRRRKPSSRCLTSILGKSNL
QFAGMTISLTVSTSSLNLLAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQR
ACHILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLVTPHDRMAPFDGSAWEEEEDEAA
APPEVPYYNNFPGKQPPPGGLVDMRARPGATLXXXXXXXXXXXXXXXXXXXXXXXPYVQQ
GQNDIHKQPLPPLPVGAKEGGRELFEDPSYVNVDKPRPLASAANGNAHRDAFDMKPFDDA
LGVSGGLGPVSAAPPLVEQLQCETWFHGSLSRRPAERLLTRDGDFLVRESGTTPGQYVLT
GQQGGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNRLPIVSAGSEVCLQQPVERRT
Download sequence
Identical sequences ENSGMOP00000008421 ENSGMOP00000008421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]