SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008472 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008472
Domain Number 1 Region: 27-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-85
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 275-397
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-33
Family Spectrin repeat 0.000000635
Further Details:      
 
Domain Number 3 Region: 398-506
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-26
Family Spectrin repeat 0.00000393
Further Details:      
 
Domain Number 4 Region: 631-743
Classification Level Classification E-value
Superfamily Spectrin repeat 6.33e-23
Family Spectrin repeat 0.00000367
Further Details:      
 
Domain Number 5 Region: 742-890
Classification Level Classification E-value
Superfamily EF-hand 7.02e-20
Family Calmodulin-like 0.008
Further Details:      
 
Domain Number 6 Region: 555-627
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000164
Family Spectrin repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008472   Gene: ENSGMOG00000007919   Transcript: ENSGMOT00000008710
Sequence length 898
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2569:57878:110572:-1 gene:ENSGMOG00000007919 transcript:ENSGMOT00000008710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDYHAANNQQYTAEGTPIYMEQENDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQI
DSIEEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGA
EEIVDGNAKMTLGMIWTIILRFAIQDISVDETSAKEGLLLWCQRKTAPYKNVNVQNFHIS
WKDGLAFNALIHRHRPELIDYDKLRKDDPLTNLNNAFEVAEKYLDIPKMMDAEDIVGTLR
PDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRR
TIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPA
FMPSEGRMVSDINGSWHALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKATIHEAWTDG
KEAMLTQKDYATATLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSV
NARCQNICEQWDSLGSLTQNRRESLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGLITAHEQFKSTLPDANKEREAIQAIQAEVQKIAQHNGINLSGTNPY
TSITPESIDSKWEKVPQRDQALQEELAKQQSNDHLRRQFATQANMVGPWIQTKMEEIGRI
SIEMNGTLEDQLTHLREYEQSIIEYKPHIDRLEGDHQLIQEALIFDNKYTAYTMEHLRVG
WEQLLTTIARTINEIDNQILTRDAKGISQEQLHEYRTSFNHFDKDHSGALMAEEFKACLI
SLGYDVENNKQGDAEFARIMGIVDPNSSGAVTFQAFIDFMSRETTDTDTADQVIASFKIL
AGDKECNFITAEELRRELPADQAEYCIARMAPYGGPDGVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences ENSGMOP00000008472 ENSGMOP00000008472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]