SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008484 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008484
Domain Number 1 Region: 2-293
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.1e-96
Family Calpain large subunit, catalytic domain (domain II) 0.000000222
Further Details:      
 
Domain Number 2 Region: 303-429
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.71e-21
Family Calpain large subunit, middle domain (domain III) 0.00055
Further Details:      
 
Domain Number 3 Region: 485-583
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000023
Family Penta-EF-hand proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008484   Gene: ENSGMOG00000007927   Transcript: ENSGMOT00000008723
Sequence length 584
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2569:113908:129778:-1 gene:ENSGMOG00000007927 transcript:ENSGMOT00000008723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFIDYTFPVGQELLAKSVEWKRPMELCKSSPPQFIVDGATRMDVCQGNLGDCWFLSALA
SLSMHRSLLKRVVPPGQGFQNGYDGSFYFRFWQYGKWEEVRVDDLLPTQNGQLYYLRSPN
RNEFWSCLLEKAYAKLKGGYQALEMGFPHEAMADMTGGVTEVLSVASFSENLPRALQHLL
RKGALINCANCQGPLEQKNEQGILFRHAYSLTAVERVETAGPVTLVRLHNPWGGTEWKGR
WSDLSGPEWNTVSEDEQRRLGRVSKEDGEFWMSVSDFRRNLEIIELCHMSDSLSQSGTTG
RPWHCQMHQGHWVPNLSAGPPVLPDPVRGDDDPSDPEKTCSFLVALMQKHQKLRVLSIGM
NVYQVHDPLSPQDLMGLAPVLGLAHVMRRETVLRGALAPGHYVIIPYASLPNQEGRFILR
VLTEKGNDAQSPFPHLKALPSPNSTRQLFRKHCSKGVCKPLNLHRLLTEAIQGGVLAGSE
RYLALEHCKSMVVLVDSKGLAVLDWPGFKTLWYKIQSWTDAFLIHDKNGSKKLEYVEVSS
AMKSAGINMDSSVMQFVGLRYTEPDMTVSYPGFLYLMMKLDSMI
Download sequence
Identical sequences ENSGMOP00000008484 ENSGMOP00000008484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]