SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008510 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008510
Domain Number 1 Region: 156-211
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-19
Family SH3-domain 0.00076
Further Details:      
 
Domain Number 2 Region: 18-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000673
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008510   Gene: ENSGMOG00000007958   Transcript: ENSGMOT00000008750
Sequence length 238
Comment pep:novel genescaffold:gadMor1:GeneScaffold_260:657612:661119:-1 gene:ENSGMOG00000007958 transcript:ENSGMOT00000008750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYFVYDEEVEEEEREPRLPRPVKPVNDKPHKFKDHYCKKPKFCDVCARMIVLNNKFALRC
KDCKTNIHHQCQSYVEFQRCYGKIPPGFRRAYSSPLYSNRTDPVFETLRIGVIMANKERK
KGSEDKKNVMMMMMEEEDSPPKGDEGRGEGVFSQSHYYLALYRFKAIEKDDLDLNAGDRI
TVIDDSNEEWWRGKIGDRTGFLPANYIIRVRAGESVYKVTRSFVGNREMGQITLKKDQ
Download sequence
Identical sequences ENSGMOP00000008510 ENSGMOP00000008510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]