SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008620 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008620
Domain Number 1 Region: 6-464
Classification Level Classification E-value
Superfamily Sema domain 2.88e-158
Family Sema domain 0.00000000289
Further Details:      
 
Domain Number 2 Region: 465-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000419
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 525-608
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000294
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008620   Gene: ENSGMOG00000008050   Transcript: ENSGMOT00000008862
Sequence length 807
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1981:2161:25592:1 gene:ENSGMOG00000008050 transcript:ENSGMOT00000008862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVLDSMARFSVPGVWNYSTVTLSDHERVLYVGAREALFALDPNDISRQRRPQIEWPAPQD
KKKECASKGKNNQTECFNYIRFLQSYNSTHLYTCGTYAYQPKCTYVIAANFTLSPAPLED
GRGKCPYDPAKGHTGLIVDEELYSATLFNFLGTEAVILRNLGHQHYSMKSDDLPAWLKEP
DFVGSSLVRESLGSKEGDDDKIYFFFSERPTEDRNCYAERTMARVARVCKGDLGGKRTLQ
KKWTTFQKARLVCSLPERHVAFNNLRATFTLPGQDWGSTIFFGIFHAQWGDVDVSAVCQY
HISDVKKVFNGDYNEYQDDSQRWTRYTGPVPSPRPGACITNWHRENGYNHSLQLPDATLN
FAKKHPLMAEEAQARPLLLTKGVNFTRLAVDRVSTLDQRSCNMLFIGTADGWLQRVVVLG
LEAHVIEEIQLFETPQPVDSLTISHSKKYLYIGSRSEVLQLPLANCSRYHSQPDCLLARD
PYCAWDSEGRACVRIDLHRHTRSTSSLSQDLMLERFSRGKDHSRLRNVTVVVGSDMVLPC
HLVSNLAQPFWVLNDRELQLGDPESGGPRFDRALRALVVPDAGQTQAGRYVCYSEEQGVK
FQTERYQVAVVASAPVFMEARAPDGSMGLFWVLVITLGAACLLLLVVALYLRRRLKLALG
KGADMKPLESTLVYPITLPKEPPTFVPSKMPTDEDRFWETGANYYYSDGSLKIVPGHALG
PSSLSSVPSPSAIPGQPIHSPSRLSLTNIRGSGSNGYMRLNLSAAAGXXXXXXXXXXXXX
XXXXEELRRTLQQRSVLPDANPEESSV
Download sequence
Identical sequences ENSGMOP00000008620 ENSGMOP00000008620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]