SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008780 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008780
Domain Number 1 Region: 83-283
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.26e-53
Family Protein serine/threonine phosphatase 0.000016
Further Details:      
 
Domain Number 2 Region: 555-632
Classification Level Classification E-value
Superfamily EF-hand 1.11e-17
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 3 Region: 414-458
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.00000000885
Family Protein serine/threonine phosphatase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008780   Gene: ENSGMOG00000008211   Transcript: ENSGMOT00000009025
Sequence length 638
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2856:31115:45914:-1 gene:ENSGMOG00000008211 transcript:ENSGMOT00000009025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAILIQGWYRRYMARLEMRRRYTWSIFQSIEYAGEQDQLQLSSFFSFMLDNFTHLNGS
GPDLISQLLDPVVDPWLGRETCYELIPVAESYSGPRISFPLSVSHTNSLVNAFKEHQTLH
ARYALQLLWETKKLLKQMPNIVHMSTSYAKEITICXGDLHGHLDDLLLIFYKNGLPSAET
PYVFNGDFVDRGKQSTEVVLILFAYLLLYPNHMHLNRGNHEYGFTKEVMQKYKTHGREIL
QLFQDVFSLLPIATVIDSKVLIVHGGISDQTDLDFLNSIERQKVKSALRLPRRSLEEPDV
SRPYKRPGPRPGSSHSRRQRPGAQTKREGGPRAFLTSLPPPSPRVEREWKQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVITIFSA
SNYYEEGSNRGAYVKLGQDLLPRFYQYQVSRTTRKLTLTQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXFVSVSEWAQVLETVLRLDLPWRTLRPHLARLAPDGSVEYLSCF
DYMGPGLHLPQVTPNLAETLVRYRTDLELIFNIIDKDHSGLISLDEFRHTWRLFSGHLGV
ALDDGAIDALARSIDFNKDGSIDFTEFLEAFRVVHKLD
Download sequence
Identical sequences ENSGMOP00000008780 ENSGMOP00000008780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]