SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008802 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008802
Domain Number 1 Region: 54-108,167-309
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-43
Family Pleckstrin-homology domain (PH domain) 0.0079
Further Details:      
 
Domain Number 2 Region: 3-72,116-194
Classification Level Classification E-value
Superfamily EF-hand 0.00000113
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008802   Gene: ENSGMOG00000008227   Transcript: ENSGMOT00000009047
Sequence length 617
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2603:204887:214258:-1 gene:ENSGMOG00000008227 transcript:ENSGMOT00000009047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRAELLKSIWYGFTALDLEKSGKVSKSQLKVLSHNLCTVLSIPHDPVALEEHFRDDDD
GPVSSQGYMPYLTKYILDKVEEGAFNKENVDELCWTLTAKKNYRPDRSTTTVLPEKDAFR
LWCLFNFLSEDKYPLVMVPDEVEYLLKKVCMAMSIELNCVELEDFTSQDVVQRNGFSVWG
FLEMMNSGKITRGMDKDITSMAIEEIYREIVGDVLKEGYLWKKGQLRRNWKERWFTLRPS
SLAYYSGEDRKECHGNITLDGNCCVEVLPDRDGKRCMFCLKTLSKTYEMSASDTKQRQEW
TTAIQTAIRLYVEGKTSLHKDLKLKRREQREQREKRRLDKEEELQRLRALQEEREHKLAE
LEVLREAQKQAQVLQEQDEQKRREQHEQLHRTLEIQLREAEEARASMQAEMVLKEEEAER
QKKRIHELEEMQKHLKEALQLEIKARMDEEAFRYAQTGLLAEEEEKMKALMALQEEQEEY
IVKTQREKQELKQEMETKSRALDEAQRQLETVRANRYRVDQDVVAAQRKLRQASTNVKHW
NVQMNRLMRPIGPGEKRPSLGSSYSSFPMPCQRDPGLRLRPRAEGKDEESKENLDNGAGC
GDEKRLSQASNGEMDTP
Download sequence
Identical sequences ENSGMOP00000008802 ENSGMOP00000008802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]