SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008848 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008848
Domain Number 1 Region: 1171-1326,1366-1445
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1496-1686,1719-1744
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-37
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 3 Region: 726-873,907-954
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-30
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 136-280,353-422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-28
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008848
Domain Number - Region: 1751-1798
Classification Level Classification E-value
Superfamily EF-hand 0.0174
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008848   Gene: ENSGMOG00000008271   Transcript: ENSGMOT00000009093
Sequence length 1958
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2603:343020:386229:1 gene:ENSGMOG00000008271 transcript:ENSGMOT00000009093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLLAPPGPNSIKEFTLESLANLELRFKDAKNKKPPRQDSSYRDDDDENKPKPNSDLE
AGKSLPFIYGEIPKGLVAVPLEDLDPFYAATQKTFIVLNRGKTIFRFSANPALYFISPLN
FARRMSIKILIHCLLTLFSMIIMCTILTNCIFMTFSDPPEWSKQVEYTFTGIYTFESLVK
ICARGFCIDGFTFLRDPWNWLDFMVISMAYITEFVDLGNVSALRTFRVLRALKTISVIPG
LKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRHKCVIWPINATDNYLANG
SRGFEWNEYINNDTNFYFLPGSLDALLCGNSSDSGRCPEGYTCMKAGRNPNYGYTSFDSF
GWAFLALFRLMTQDFWENLYMLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEE
QNQATMEEALQKEEEFKNMLEQLKRQQEDAQTAAMATSAGTVSEDAVEDDGGEHMSCSSS
DMSKLSSKSAKERRNRKKKWRQKEQDKEKGDSEKFVKSESDEGSKGRSRFRFPDNRLGRK
SSIMNQXXXSIPGSPFLSRHNSKSSIFSFKGRGKDPGSENEFADDEHSTVEECEERRGSL
FSPYRRNSYTGYHGKRNSTVDCNGVVSLIGPGGRLLPEPTTEVEVKKKLSGSLMVSVDQL
NTSFGRKERANSVMSVITNTLVEELEESQRSCPPCWYKFSNTFLIWECSPAWLKIKEIVN
LIVMDPFVDLAITICIVLNTLFMAMEHYPMTPQFEGVLSVGNLVFTGIFAVEMFAKLVAM
DPYYYFQEGWNCFDGFIVTLSLVELALADVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKI
IGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKIAVDCKLPRWHMNDFFHSFL
IVFRVLCGEWIETMWDCMEVAGQGMCLIVFMMVMVIGNLVVLNLFLALLLSSFSADNLAA
TDDDGELNNLQISVIRIKKGIAWFKAKVRVLMASLLKKPLQTDEQKPLDDMYDKKLNCIA
NHTGVDINRELDYVKNGNGTTSGIGSSVGKYMIDEDHMSFIHNPNLTVCVPIAVGESDFE
NLNTEDFSSESENENSKEMDDTSSSEGSTIDIKPDVVEEVVVETVEEYLDPAACWTDACV
AKYKCCDVPITHGWGKPWWFLRKTCYLIVEHNWFETLIIFMILLSSGALAFEDVYIEQRK
TIRIVLEYADRVFTYIFILEMLLKWVAYGFVKYFTNAWCWLDFFIVDVSIVSLVANALGY
SDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGV
NLFAGKYYYCFNQTSEEMFSDKVVNNKTECFALINDNYTEVRWKNVKINFDNVGAGYLAL
LQVATFKGWMDIMYAAVDSRQVESQPIYEDNIYMYIYFVIFIIFGSFFTLNLFIGVIIDN
FNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPQNKIQGMVFDFVTQQVFDI
SIMILICLNMVTMMVETDDQSDETELVLYWVNFIFIVVFTTEFVLKLFALRHYYFTNGWN
IFDVVVVILSIVGMFLAEIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMM
SLPALFNIGLLLFLVMFIFSIFGMSNFGYVKHGAGIDDLYNFETFGNSMICLFMITTSGG
WDGLLLPILNYPPDCDLTLENPGTSVKGDCGNPSVGIFFFVMYIIISFLIVVNMYIAIIL
ENFSVATEESADPLSEDDFETFYEIWEKFDPTASQFITFTKLGDFADALEHPLRVPKPNT
IELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDMLRQQMEERFVAANPSKVSYEPI
TTTMRRRQEDVSARIIQKAFRSHLIRRGIIFKRFPFGINRLENGGNNQEKKESTPSTASL
PSYDSVTKPDKEKPEENEDNAGRKEKDKNQKDERESKC
Download sequence
Identical sequences ENSGMOP00000008848 ENSGMOP00000008848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]