SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008850 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008850
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-33
Family FKBP immunophilin/proline isomerase 0.00028
Further Details:      
 
Domain Number 2 Region: 140-204
Classification Level Classification E-value
Superfamily EF-hand 0.000000000328
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008850   Gene: ENSGMOG00000008272   Transcript: ENSGMOT00000009095
Sequence length 211
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2256:181:36349:-1 gene:ENSGMOG00000008272 transcript:ENSGMOT00000009095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWSPIGFTCQSLAAEDDSSSEVKIEVMFKPMECSKKSKRGDLMNVHYDGYLAKDGTQFYC
SRSDKAGHPQWFVLGVGQVIKGLDQGMNDMCPGEKRKITVPPSLGFGKEGKDPIDPVVPP
NATLVFEVELYSVSKGPRNMEAFREIDLDQDKSLTKEEVKRYLKLDYERSGTPKDDAFYD
KIMEDIFKKNDLDVNGLITSKEYNVYQHDEL
Download sequence
Identical sequences ENSGMOP00000008850 ENSGMOP00000008850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]