SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008910 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008910
Domain Number 1 Region: 1-401
Classification Level Classification E-value
Superfamily Sema domain 2.62e-103
Family Sema domain 0.00000106
Further Details:      
 
Domain Number 2 Region: 403-445
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000471
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008910   Gene: ENSGMOG00000008331   Transcript: ENSGMOT00000009156
Sequence length 533
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2130:62833:70117:1 gene:ENSGMOG00000008331 transcript:ENSGMOT00000009156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLGGTDFVLKIDVDSNYVMETFQLNKSANEVCSQGPCRNVITVIEEFQDSLFVCGTNGYK
PQCWKLYSQVGNRSSEIVESYDGTGISPYVYTQNRLSLTVEGDLYAAAPLEYDGSSLQFR
RKAGSRTNVWMYDNWVSEPTFVAASWVRRKEDRENEKIYIFFREKNSDSSPEADPWVTRV
ARVCKVDEGGSKRFFQNTWTSFLKARLVCGYPKESLYFNHLLDVYVLHADNWRDSRVYAL
FTSSWNSTAVCVYSMADIDDVFEKSNFKGYEGDIPDPRPGTCVKNSRGLPYATLNVVKDH
SEMSEWLHSSIHPLAPFYVSSYNYTKLAVDRVRAADQHTYNVLLLATDTGKIHKCLELGS
DTFIISETHLSNHSSVQSMILSSKKKKLIVSFAEEVFILDLPQCHHYNSSCAECVLSRDP
YCAWTQNRCTSTIIHLEPKTLDKNRQETVRPTQAVSRAAHVVPLGVPFYLSCPIDSYHAT
YVWKHVGGDTSSCQQMGSQCLHLIPALKSGSYGRHQCFSQERGYTRLVAEYLL
Download sequence
Identical sequences ENSGMOP00000008910 ENSGMOP00000008910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]