SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008951 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008951
Domain Number 1 Region: 160-346
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.76e-26
Family Protein kinases, catalytic subunit 0.00000747
Further Details:      
 
Domain Number 2 Region: 17-102
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.49e-17
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008951   Gene: ENSGMOG00000008357   Transcript: ENSGMOT00000009197
Sequence length 356
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1125:4652:10205:1 gene:ENSGMOG00000008357 transcript:ENSGMOT00000009197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDSPVHPGFYRTEVQKTTWDVPERYEALKPIGSGAYGTVCSALDKQTKEKVAIKKLYRPF
QSLIHTKRAYRELRLLRHIENDNVSPYTQCYLVVDDDELYLSIHHVWISETYSRPGRSYR
ASHTPLDPLIPQGLECQQEPDEGTMWDRDRLGQLNCFSFIISDFDFGRVSDVCGSPPVEK
YGCRISYMLLLLSYYSQSVDVWSAACILAEMITGKVVFPGHDSILSIDQLKKIMSLTGTP
ASALVQKMQSADAQSYVQGLPLQKKKVFSEVFPSMDKKAVDLLEAMLLLDPESRLTAAQG
LSHPYLAEFHDPESEPGSQAYDDSFESLELDIGEWKSLIHMEIMTFDPVNPRNTAM
Download sequence
Identical sequences ENSGMOP00000008951 ENSGMOP00000008951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]