SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008969 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008969
Domain Number 1 Region: 247-337
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000417
Family Synaptotagmin-like (S variant) 0.052
Further Details:      
 
Domain Number 2 Region: 196-248
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000228
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008969   Gene: ENSGMOG00000008379   Transcript: ENSGMOT00000009215
Sequence length 340
Comment pep:novel genescaffold:gadMor1:GeneScaffold_373:20432:41553:-1 gene:ENSGMOG00000008379 transcript:ENSGMOT00000009215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGPVAYRLSCGQPSVSEPGAWERKYCILTDTHLLLLNKTQDIGQSDGLQSPTDSTRSRSL
RRTVSVPSDGQFPDQPPEGAPMPEVSSERSPRRRSISGVGGSEKSVAVDNPNSSPFKVPG
YFLSAEKGSQRPTGPQTQLHTHIYTLPDIQIAHDKNRSRALPKLKETSSHESLLSPGSAV
EALDLAMEDHVYIKPLHSSILGQEFCFEVTYSGGTKCFSCTSMSERDKWMENLRRTIQPN
KDNCRRVENLLRLWIIEAKDLPAKKKYFCELCLDDTLYARTTSKMRHDSLFWGEHFDFSS
LPPVHSLTVHIYRDVDKKKKKEKNNYVGLVNIPVSTVTGR
Download sequence
Identical sequences ENSGMOP00000008969 ENSGMOP00000008969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]