SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009006 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009006
Domain Number 1 Region: 82-287
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.7e-40
Family NAD kinase-like 0.0046
Further Details:      
 
Domain Number 2 Region: 317-407
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.1e-19
Family NAD kinase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009006   Gene: ENSGMOG00000008413   Transcript: ENSGMOT00000009252
Sequence length 417
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1210:48803:68255:-1 gene:ENSGMOG00000008413 transcript:ENSGMOT00000009252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YCCSTCDGGEGHGRTLRHTRKPRSLSTSSSSSSDNRRTQSLHGPSPVTTFGPKACMLHNP
NTIMHIQDPASQRLTWNKPPKSVLVIKKIRDAGLLQPFKELCTFLTEVKSMIVYVERKVL
EDPAIAGDDAFRTTMNKFCTFRDDLDDISNYVDFIICLGGDGTLLYASSLFQESVPPVMA
FHLGSLGFLTPFNFDTYQSQLNQVIEGNVSIVLRSRLRVRVQKDSREKRAKVEENGVILT
NGDGEGMHKAAQYQVLNEVVVDRGPSSYLSNVDLFLDGHLITTVQGDXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXITPICPHSLSFRPIVVPAGVELKVMLSSEARNTAWVSFDGRKR
QEICHGDSSITITTSCFPVPSICFRDPVTDWFESLAQCLHWNVRKKQHHLTSEEEEF
Download sequence
Identical sequences ENSGMOP00000009006 ENSGMOP00000009006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]