SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009026 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009026
Domain Number 1 Region: 938-1191
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-73
Family Protein kinases, catalytic subunit 0.00000000124
Further Details:      
 
Domain Number 2 Region: 22-162
Classification Level Classification E-value
Superfamily Sema domain 1.96e-34
Family Sema domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 257-355
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000000772
Family Sema domain 0.00035
Further Details:      
 
Domain Number 4 Region: 497-583
Classification Level Classification E-value
Superfamily E set domains 0.000000000000356
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 5 Region: 357-404
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000136
Family Plexin repeat 0.00083
Further Details:      
 
Domain Number 6 Region: 401-466
Classification Level Classification E-value
Superfamily E set domains 0.000000878
Family Other IPT/TIG domains 0.053
Further Details:      
 
Domain Number 7 Region: 581-672
Classification Level Classification E-value
Superfamily E set domains 0.00000293
Family E-set domains of sugar-utilizing enzymes 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009026   Gene: ENSGMOG00000008433   Transcript: ENSGMOT00000009273
Sequence length 1264
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4138:5147:59232:-1 gene:ENSGMOG00000008433 transcript:ENSGMOT00000009273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPQPSDPNRVVRPSGARVLNVESNVIHFFAGNSEIPGDGRAGGAAAPHTMSVRKMKTSQN
GFTFFSHRSYIDLIPALRGNYFLRYVYSFHSGPFTYFLTVQRAGRGSQAYHTRIVRMCSS
DLQIRRYVEMPLQCICTDKRRRRGVGAVRVFNVLQAAHLAKVXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
SSDDCGLHEGLNEGKEGEYRLEVVQDAQRLEYWQKDLTDTLVTSISVAMVHGHIVAYLGT
EDGRHIQVLFSRAASPHVNVRLDSRPVTTMVLLDPEGPGGALLLATGSKITKVPLTGPGC
GQLTSCTSCLLSSGVTGCGWCGDRCTRANECPLTSRWTQDYCTPVIKKVWPATGPLRGTT
VLTICGENFGFNKTESFKSSLVTVEVAGAACKLYRQDRLKWNELQCSPVSSGNFTPSGRT
VKVTSGNKFDQKEAFSFVDPVIEEIFPEFGPKSGGTVLTIRGAFLDAGTKREVTVGKAVC
KIQSVISTTLICKPALSGTSNQPVTLTLDGVERRAPGPFTYNQDPVINSIQPSRSFISGG
CTLSAHGFFLQSGLLPQMFISVPHEGKLLHASCVYGENRTTIQCITPSLAKLALQPPTVT
RVAFILDGFQTPQVDLIYVEDPLFQDPKLTSKDNKSVVELKGSHMDIEAMKCQVLTVSNH
SCESLSVVGNTAECTVPRLLQGPARPKELQVEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXHSEVWYDMGTNIQHLDRLANARSVSPTNELVSHESV
DYRATLLEDQGMERPEACRGAPPPIYGANRELLSPRLGALGAGLRMGADGELVAPLLVAP
VHIDPSRLHPQLLQEVQHVVIARDRLLLXXXXXXXXXHFGCVFHGTLLEADGQKQHCAVK
SLNRITDLEEVSQFLKEGIIMKDFSHPNVLSLLGICLPPEGSPLVVLPYMKHGDLRNFIR
DEGHNPTVKDLMGFGLQVARGMEYLASQKFVHRDLAARNCMLDESFVVKVADFGLARDVY
DKEYYSVHNKNAVKLPVKWMALESLQTHKFTTKSDVWSFGVLLWELMTRGAPPYSDVNSF
DITVYLMQGRRLLQPEFCPDALYTVMVECWHPRLERRPTFSELVARISGIFSSFSGEHYV
LLNTTYVNLDKMSPYPPLLSPTSPYPRTSTSSFSSASSSSHYPSASTSLPPPSPCCRPHL
ACCT
Download sequence
Identical sequences ENSGMOP00000009026 ENSGMOP00000009026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]