SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009046 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009046
Domain Number 1 Region: 8-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.22e-54
Family G proteins 0.0000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009046   Gene: ENSGMOG00000008450   Transcript: ENSGMOT00000009293
Sequence length 215
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3839:37416:46135:-1 gene:ENSGMOG00000008450 transcript:ENSGMOT00000009293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIK
LQIWDTAGQERFSRSITRAYYRNSVGGLLLFDITNRRSFQNVHDWLEEARSHVQPHSIVF
LLVGHKCDLEAQRQVTRQEAEKLAGAYGMRYVETSARDAINVEHAFTELTRDIFALVRSG
DITIQEGWEGVKSGFVPNVVHSSEEVTKSDRRCLC
Download sequence
Identical sequences ENSGMOP00000009046 ENSGMOP00000009046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]