SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009068 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009068
Domain Number 1 Region: 11-216
Classification Level Classification E-value
Superfamily Sema domain 4.97e-56
Family Sema domain 0.0000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009068   Gene: ENSGMOG00000008463   Transcript: ENSGMOT00000009315
Sequence length 995
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2886:78141:89568:1 gene:ENSGMOG00000008463 transcript:ENSGMOT00000009315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRQYPVFRGRPSGNESQHRLDFQLMTKIQDTLFIAGRDQVYLVSLRESYRNEIIPYRKLT
WRSGPADREMCAVKGKHRDECHNFIKVLVPRNDDLVFICGTNGFNPMCRYYRLDNLEFDG
EEISGLARCPFDSKQTNVALFADGKLYSATVADFQASDAVIYRSMGDGSALRTIKYDSNG
LKVREPHFLHAVEYGNYVYFFYREIAVEHNSLGKVRAVRLELSSPTPPSPTPHTNVHLEN
RLVFPVAGVPVEIPSGSGPLVRAYFVLGYMSQLQGRYSPVDVLPLCNYYAGSGFISRGCA
LAFCRSRSRSLSLPVSNMRSPGQTQTCTHVHARREGIRECCVWRQLPFGPDWGGGCVRSA
AAAGSTLSTPAAGLINNVVMLMLRVNTWRLICRSRPLHWRPRLHSSLRKLCAIVCPERQC
AHTHCRSLLHSHCTAGQTGEGYEQDVEFGDTAQLGDCHAFLPSTSAPGYKSFGDPTSDMD
FSSAPVTAGLPSGPILPPVLIPTQSPGSGPDPDAFGSGHVLQDDPATSHSLDSVPGGHEG
IWDIQASEANQMVHMNILITCVFAAFLLGALLAGLVVFCYRDSVLHKPRRVRKDAEAVPP
CSDSTGSFAKLNGLFDSPVKEYHPNMDSPKMYTNLLSNGKDLASPSGDVKTMILCDGCQP
PELAALPTPESTPVLQQKGLQPIKNQWERASAKVSSSRKESNPAAKSSQFLPSSSPAPPT
ANPHHPHPPLGHSHIPSAVVLPNATHEHPDDERADGAPPCLSDKKAKNPEAKGSRKEQKR
SVDARNTLNDLLKHLNEAGANPKGLLQEGSGPRPRPHLMLEPMEALTEVPPKVPSREASL
YSPSSSLPRHSPTKRVDVPMPSSPTGSLSMGGTLERQARGYHLHRSASHRQSLSTSPNGV
TMGVSMSRQHSMNRGGGYMPPTPPSRMDSHGGAMAAGMHSPHPPSLSRQSSYSGYGSLPR
TGVKRTPSLKPDVPPKPNGFPPQTPQMRVVNKFSY
Download sequence
Identical sequences ENSGMOP00000009068 ENSGMOP00000009068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]