SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009176 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009176
Domain Number 1 Region: 139-300
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.96e-38
Family Reductases 0.00000816
Further Details:      
 
Domain Number 2 Region: 35-154
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.12e-38
Family Ferredoxin reductase FAD-binding domain-like 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009176   Gene: ENSGMOG00000008577   Transcript: ENSGMOT00000009426
Sequence length 302
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4214:99053:109469:1 gene:ENSGMOG00000008577 transcript:ENSGMOT00000009426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SACPFCSNVVAFDAIAITCNAMLLSLRLPKRRTAITLVDPNIKYALRLIDKQIVSHDTRR
FRFALPTAGHILGLPIGQHIYLSAKIDGKLVVRPYTPVSSDDDKGCVDLVIKVYFKDVNP
KFPEGGKMSQYLESLKLNDAIDFRGPSGLLVYKGKGSFAIQPEKKAPAVIKKARQLGMIA
GGTGITPMLQIISAIMKDSQDATVCHLLFANQTEKDILLRPELEEIQANHPDRFKLWFTL
DQPPADWDYSEGFISEDMVRDHLPGPSEDALILMCGPPPMVQFACNPNLDKVGHSSSQRF
IF
Download sequence
Identical sequences ENSGMOP00000009176 ENSGMOP00000009176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]