SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009200 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009200
Domain Number 1 Region: 8-45
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000536
Family HkH motif-containing C2H2 finger 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000009200
Domain Number - Region: 166-185
Classification Level Classification E-value
Superfamily WW domain 0.00815
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009200   Gene: ENSGMOG00000008593   Transcript: ENSGMOT00000009450
Sequence length 391
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2746:79281:86126:1 gene:ENSGMOG00000008593 transcript:ENSGMOT00000009450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADYWKSQPRKFCQYCKCWIADNKPSVEFHERGKNHKENVSLKIAEIKKKSQDKAKQDERM
SKEFATMEEAAMKAYKEDLKRMQLEAGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSAGAWMEALSPEGYSYYF
NSETGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXKRKVEPLSDPRVKQRAGEVGRGVEKKKKKGQGATPPPEETQEEKEKREAASEK
KPAKRPRRTTPYGTWEQIQPEEDPYANVDLQLPQVEEFDRAPAVVPPEPKPKFRERTITS
LGGDQSGPAAFRKSKTHNGKARSLRQRGEDD
Download sequence
Identical sequences ENSGMOP00000009200 ENSGMOP00000009200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]