SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009246 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009246
Domain Number 1 Region: 196-470
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.28e-77
Family Mitochondrial carrier 0.0000592
Further Details:      
 
Domain Number 2 Region: 24-171
Classification Level Classification E-value
Superfamily EF-hand 2.11e-35
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009246   Gene: ENSGMOG00000008646   Transcript: ENSGMOT00000009498
Sequence length 478
Comment pep:novel genescaffold:gadMor1:GeneScaffold_468:74035:85507:-1 gene:ENSGMOG00000008646 transcript:ENSGMOT00000009498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STMYYQAIRRLVFTDCSCATDASKTYEDLFEKLDTNKDGKVDVAELRAGLTSMGITFRKG
AAQKIISSGDKDKDLGLDFEEFSKYLKDHEKKLRLTFKSLDKNNDGCVDHMEVRQSLADL
GMDINQEEAKKILQSIDVDGTMTVDWNEWKAHFLFNPATNLQEIIRYWKHSTXXXXXXXX
XXXXXXXXEEKTTGIWWKQLSAGAMAGAVSRTGTAPLDRMKVFMQVHSTKSNKISLVGGF
KQMLKEGGAASLWRGNGINVLKIAPETAIKFMAYEQYKKLLSSDRGKVRTHERFIAGSLA
GATAQTAIYPMEVMKTRLTLRKTGQYTGMFDCAKKILQKEGVKAFYKGYLPNILGIIPYA
GIDLAVYESLKNAWLANYAKDSANPGILVLLGCGTMSSTCGQLTSYPLALIRTRMQAAAS
IEGAEQMSMNRMVKKIVEKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGIQK
Download sequence
Identical sequences ENSGMOP00000009246 ENSGMOP00000009246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]