SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009308 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009308
Domain Number 1 Region: 550-638
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-19
Family Third domain of FERM 0.0058
Further Details:      
 
Domain Number 2 Region: 350-449
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-17
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 3 Region: 251-304
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000613
Family Second domain of FERM 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000009308
Domain Number - Region: 487-549
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00157
Family Second domain of FERM 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009308   Gene: ENSGMOG00000008696   Transcript: ENSGMOT00000009561
Sequence length 663
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4249:128435:139183:1 gene:ENSGMOG00000008696 transcript:ENSGMOT00000009561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADWDLSVTVEELGSEAPALSISVTSDLHIGGVILKLVEKTQIKRDWSDHALWWEQKQQW
LLRTSWTLEKCEIHADASLVFMPQHKPLRLGLPNGATVRLQACFSGPVFRTLLGICRILN
IRHPEELSLLRPLEEKKKKKERDALDEVYDLTEVPLASGTRYNYQYCVYLTYISRNKNGM
PAHFADSPQTEAVYRMLSVPQPAPAPELISKQYRAASVVDKAHXXXXWLDSSRSLLQQGV
QENGRLWLRFKYSTFYNLEPYDAVRLAQLYEQARWAVLLEDVDCTEEEMMLFGALQYHIS
KRSLSEPQTVTSNAAMDDLETALLSLEVKLDGDSNTANDMLDNMAAPELSDYLKIFRPKR
LTLKGYKQYWFKFQDTGISYFKSKEESVGEPIQQIHLKGCEVAPDVNVAGQKFLIRLLIP
APEGMTEVYLRCENEEQYAHWMAACRLASTGRSLADSSFQSEIQSIRSFLAMQKTHGNSS
VPAADDAINPHSLVSPRYQKKYKAKQXXXXXXXXXLTQRILEAYQNVAQLSWNDALLRFL
QIWQALPDFGLSYVVVRFKGSRKDEVLGIAPNRLIRIDLGVGDVVRTWRYNNMRQWNVNW
DIRQVAIEFDGNVNIAFSCVTADCKIVHEFIGGYIFMSTRTKEQGDALNQELFHKLTGGH
EAL
Download sequence
Identical sequences ENSGMOP00000009308 ENSGMOP00000009308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]