SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009311 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009311
Domain Number 1 Region: 744-887
Classification Level Classification E-value
Superfamily Spectrin repeat 2.57e-38
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 1293-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-36
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 3 Region: 524-677
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-35
Family Spectrin repeat 0.0000555
Further Details:      
 
Domain Number 4 Region: 1824-1980
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-34
Family Spectrin repeat 0.000003
Further Details:      
 
Domain Number 5 Region: 103-252
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-34
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 6 Region: 1718-1861
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-33
Family Spectrin repeat 0.00000365
Further Details:      
 
Domain Number 7 Region: 1408-1553
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-32
Family Spectrin repeat 0.0000264
Further Details:      
 
Domain Number 8 Region: 204-361
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-32
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 9 Region: 420-569
Classification Level Classification E-value
Superfamily Spectrin repeat 3.98e-31
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 10 Region: 12-146
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-30
Family Spectrin repeat 0.0000107
Further Details:      
 
Domain Number 11 Region: 1930-2085
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-28
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 12 Region: 2091-2205
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-26
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 13 Region: 1559-1663
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-24
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 14 Region: 2314-2471
Classification Level Classification E-value
Superfamily EF-hand 7.62e-23
Family Calmodulin-like 0.0043
Further Details:      
 
Domain Number 15 Region: 2207-2322
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-20
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 16 Region: 970-1033
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 17 Region: 888-965,1054-1097
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 18 Region: 1062-1180
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-18
Family Spectrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000009311
Domain Number - Region: 1213-1244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0126
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009311   Gene: ENSGMOG00000008663   Transcript: ENSGMOT00000009564
Sequence length 2478
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3708:63964:112266:1 gene:ENSGMOG00000008663 transcript:ENSGMOT00000009564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMDTSGAKVLETADDIQERRQQVLDRYRRFKELSMVRRQKLEDSYRFQFFRRDADELEKW
IQEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANAGAIIKLDETGNLMITEGHFASET
IRTRLEELHRLWDLLLLKTKEKGMRLLQAQKLVQYLRECDDAMDWINDKETMATSEELGQ
DLEHVELLQKKFEEFQTDLAAHEERVNEVNQLAARLTQEAHPEAELIVRKQDEVNAAWQR
LKGLALQRQGRLFGAAEVQRFNRNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKH
EGLERDLAALEDKVNMLGGESERLQQTHPQNAAQIHLKKDELVTNWEQIRTLAAERRARL
NDSYRLQRFTADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSF
RAADEAGQALLNTGHYASDEVKEKLGVLTEEKESLLELWELRRQQYEQCMDLQLFYRDTE
QVDNWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIDNN
HYAKEDVATRRDALLNRRNALHERAQSRRAGLEDSFHLQQFFRDSDELKSWINEKMKTAT
DEAYKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELLDGKHYAADEVSGRMEEVS
SQWKKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGQLASDDYGKDLTSVQNLQ
KKHALLEADVAAHQDRIDGITIQARQFQEAGHFDADNIRKKQEALVTRYDGLREPMTARK
QKLSDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEISGHE
PRIKAVSQKGDAMVEEGHFAAEEVKVKLGELNGRWDTLKGKAAQRRQDLEDSLQAQQYFA
DANEAESWMREKEPIVGSPDYGKDEDSAEALLKKHEALMSDLSAYGSSIHALKEQAQSCR
QQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVP
AAYVKKLDPTQSSSRENLLDEQGSIALRQEQADNHRLVAKEACSVSVRMKQVEELYGTLL
ELGDKRKDMLEKSCKKFMLFREANELQQWINEKEGALTNEEMGSDLEQVEVLQKKFDDFQ
KDLKANESRLRDINKVASELESEGLMAEEAPMVQSQQQEMLGSAPSKDEADAKNASPWKN
VRMAVQTTANFNTIKELNNRWRSLQQLAEDRSNMLGSAHEVQRFHRDADETKEWIEEKNQ
ALNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAVDDIQEKC
TELNTAWSSLVGRADQRKDKLGNSHDLQRFLSDFRDLTSWINGIRGLVSSEELAKDVTGA
EALLERHQEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIQQKLEALDSERAGLEKAW
VQRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAI
TVQEEKIAALQSFADQLIGADHYAKPEIFNRRTEVLDRWLRLKTQMIEKRSKLGESQTLQ
QFSRDVDEIEAWISEKLQTATDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDTGN
ALIQRGACSGSEDAVKVRLNALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDFDFWL
SEVDALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMGSIAFDTTV
VKDKRDAVNGRFAKIKSMAAGRRAKLNESHRLHQFFRDLDDEESWIKEKKLLVSSEDYGR
DLTGVQNLRKKHKRLEAELGAHEPAIQSVLETGKKLSDDNTIGQEEIQQRLAQFVDHWKE
LKDLSGARGQRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLKKHEA
FETDFTVHRDRVNDVCTNGDELIKKNNHHVDNISAKMAALRGKVSELERAAAQRKAKLDE
NSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIT
NITALMDQLLAAQHVQSKAIETRHAALIKRWNQLLSNSAARKKKLLEAQQHFRKVEDLFL
TFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHDAFRSSLSSAQADFGQLAELD
QQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHA
NTFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEE
ALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKH
FDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGNVSLQEYMAF
MISRETENVKSSEEIESAFRALSTEAKPYVTKEELYQNLTKEQADYCMSHMKPYLDGKGR
ELPSAFDFVEFTRSLFVN
Download sequence
Identical sequences ENSGMOP00000009311 ENSGMOP00000009311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]