SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009360 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009360
Domain Number 1 Region: 2-367
Classification Level Classification E-value
Superfamily Sema domain 3.79e-83
Family Sema domain 0.00000662
Further Details:      
 
Domain Number 2 Region: 364-400
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000068
Family Plexin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009360   Gene: ENSGMOG00000008751   Transcript: ENSGMOT00000009613
Sequence length 522
Comment pep:novel genescaffold:gadMor1:GeneScaffold_415:2853:24383:-1 gene:ENSGMOG00000008751 transcript:ENSGMOT00000009613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LECDNFITVVQKVNDTFVVCGTNAGSPKCWLLGSGLIGSPSDISPPYPSQKAISLATDGG
SLYSALSSVGGHTGSIRRTFGSQKLLKAENVWLLNPQFAGAAIIPSSLKYKEEIYFFFSE
FNKTARVDEEPYRARIGRICTVDEGGIKPLLTDSWTTFMKARMMCGSGSTQQQYNNIRQA
VVLTAQDKRAGVLYGLFSNPWGRTVICAYSIEDIDQAFSTSKLRGYSSPFTGNRPGTXXX
XXXXXXXXXXXXXXGIIRYHPEIEDVIRPVGVAPLDLPTDDQITHTVADIVLAVNDEHYS
VLYLGTEQGKVLKVLHTSEDAFVIAQYTLFHNEGPVQNMAIDGPKGHLYVGTAMEVQRLQ
LADCGRYGDTCRDCILSRDPYCGWDRARRKCVPIPTGYNITTVQQVSDSEPRSVQRFNVV
VGSSTSVFLPCPVRSFHATYRWEMDNFMKSYPCLFSGDSCVLGPTAVDLPLKEGVFRCMA
TEDGVKTEVISYRLVYNAGPLAASLASTLGSSLLLAVAALWL
Download sequence
Identical sequences ENSGMOP00000009360 ENSGMOP00000009360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]