SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009432 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009432
Domain Number 1 Region: 235-509
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.09e-78
Family Mitochondrial carrier 0.0000267
Further Details:      
 
Domain Number 2 Region: 47-210
Classification Level Classification E-value
Superfamily EF-hand 5.1e-35
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009432   Gene: ENSGMOG00000008812   Transcript: ENSGMOT00000009687
Sequence length 518
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3708:161987:172674:-1 gene:ENSGMOG00000008812 transcript:ENSGMOT00000009687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGGGDRHAEEHDCTSPKPPTARPVFCVCYTEQFHSLLPHPCELCGGPEQDHRLKVLFQI
LDVNGDGGICVNDLSIGLKKLGVHRTEHELMKIVKAGDKDLDGQLDFGEFVHYLRDHEKK
LRLVFKSLDKKNDGRIDSQEIMQSLRDLGVNISEQQAEKILKRIRGSCLAPIMYMDKNGT
MTIDWNEWRDYHLLHPADNIPEIILYWKHSTIFDVGESLLVPDEFTAEEKQTGMWWRHLV
AGGGAGAVSRTCTAPLDRLKVLMQVHSSKSNSMRIAGGFTNMVREGGVRSLWRGNGINVI
KIVPETAIKFMAYEQIKRLIGSNQETLGIAERLVAGSLAGAISQSTIYPMEVLKTRLALR
KTGQYQGIGDCAKRIFRNEGMSAFYKGYVPNMLGIIPYAGIDLAVYETLKNWWLQSYATD
SADPGVFVLLACCTTSSTCGQLASYPLALVRTRMQAQATMAGGPQMTMCGLFRHILRTEG
PLGLYRGLAPNFMKVIPAVSISYVVYEHLKMYLGVRSR
Download sequence
Identical sequences ENSGMOP00000009432 ENSGMOP00000009432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]