SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009486 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009486
Domain Number 1 Region: 17-178,216-279
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-68
Family BAR domain 0.00041
Further Details:      
 
Domain Number 2 Region: 275-376
Classification Level Classification E-value
Superfamily SH3-domain 2.4e-16
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009486   Gene: ENSGMOG00000008863   Transcript: ENSGMOT00000009742
Sequence length 377
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3708:195476:209828:-1 gene:ENSGMOG00000008863 transcript:ENSGMOT00000009742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNVKKLASDAGVFFGRAVQFTEEKLGQAEKTELDTHLENLITRADNTKNWTEKIFRQT
EVLLQPNPSARIEEFFYEKLDKKVPSRVTNGELLGQYMLEASRDFGPETPYGSTLSTVGE
YQRRLGGAEREFLLTSSMNFLTPLRNFLEGDWKTITKEKRLLENRRLDLDICKARVKKSK
QAEAKAATAPDFQETRPRNYVLSASASAXXXXXXXXAEHELRVAQTEFDRQAEVTRLLLE
GISSTHLNHLRCLHEFAEAQAKYYAQCHQFMLELQKELNGPPLSTPDVCPAPSSSARPPP
RAPGPTAAIEDMILPATGTRKARVLYDYDAHDSSELSLLADEVITVYTVPGMDPDWLVGE
KGNQKGKVPVTYLELLS
Download sequence
Identical sequences ENSGMOP00000009486 ENSGMOP00000009486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]