SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009549 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009549
Domain Number 1 Region: 18-222,264-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.38e-63
Family Calponin-homology domain, CH-domain 0.0000179
Further Details:      
 
Domain Number 2 Region: 302-423
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-32
Family Spectrin repeat 0.0000784
Further Details:      
 
Domain Number 3 Region: 1017-1174
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-29
Family Spectrin repeat 0.0000306
Further Details:      
 
Domain Number 4 Region: 910-1065
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-27
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 1230-1383
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-24
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 6 Region: 2172-2283
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-23
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 7 Region: 1609-1709
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-20
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 745-858
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-20
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 432-534
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-19
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 10 Region: 1906-2028
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-19
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 1712-1818
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-18
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 12 Region: 499-603
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000314
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 2012-2094
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000641
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 14 Region: 1356-1457
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000331
Family Spectrin repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000009549
Domain Number - Region: 1509-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000222
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number - Region: 1814-1931
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00169
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number - Region: 1178-1249
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00892
Family Spectrin repeat 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009549   Gene: ENSGMOG00000008915   Transcript: ENSGMOT00000009808
Sequence length 2308
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1768:49610:96624:-1 gene:ENSGMOG00000008915 transcript:ENSGMOT00000009808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAAMMASITDFDSAEITQQYSRVNTRFEITDEDLDHDNTSARLFERSRIKALADEREAV
QKKTFTKWVNSILARVGCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLEN
VDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDIVVETGGADQKETR
SAKDALLLXXXXXXXXYPNVNITNFTTSWKDGMAFNALIHKHRXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVFTENPDEKSIITYVVSFYHYFSKMKQLAVEGKRVGKV
LDQAIETEKMVDKYECLASDLLAWIEQTIAGLHNRKLANSLSGVQQQLQAFNSYRTAEKP
PXXQEKGNLEVLLFTIQSRMRANNQKVFTPRDGALVADINRAWERLERAEHERERVLRDE
LIRQEKLEQTARRFDRKASMRETWLLENQRLVAQDNFGYDLPAVEAAKKKHDAIETDIAA
YEERVLALVAISGELEAERYHDARRIDVRKDNVLRLWDYLQELLRARRGRLDKNLTLQSI
FQEMLYIISWMDDMKARLLSPDFGKHLSEVEDLLQKHALVENDIALQAERVQSANANALT
FANGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDVRRQWQELEDLAAFRKQSLQDTQKFFQFQGDADDLTAWLLEAKRQMGSPEVGT
DEYTTQRLLRKHRDLRNETAKNGATIDALSRQAQALPEELRNTPDIQRRLKDIRELYVEL
MALADVRQKALDDTMALYTVLSETDACELWMGQKETWLVGLEVPDKLEDLEIVQNRLSIL
ANDMANVQSRVDDVNQAVQQLEDSRHPRTKEIKDCQMRLNKRWEAFKAMVEEKKRRVDSA
LSLHNYGGDCGETEAWIKDKTRVIESTQDLGNDLAAVIAIQRKLFGMERDLAAIDTKLSF
LRNEADQLARDHPELADDIRARRGQLDAAWDALKKTLKDREDSLGEVSKLQTFLQDMDDF
QSWLFRTQKAVASEDVPGSLPEAEALLSLHDALRDDIANHREDFLQVKETGARVTQGQEE
DPQYQQLEQRLSGLDRGWNELQKMWDSRKDFLDQGLGFQQFMRDAKATDTILNNQEYTLA
HVEKPDTLAGAEKALKKHEDFLSTMGANEEKVEATVKTGQRLVDAENLYSGKVKDKMASI
TERHNANQRRATEVSGKLKDNRDLQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKW
LKHQAFMAELASNKGWLDNIDQEGQELSEAKPEFEPLVRERLAELHALWSRLESTTQEKA
RLLFDANRSELLDQSLADVKQWLGGLQQQLHSGGGHEEEVRDLTNANILLKKHQVTESQV
RERARELEELQEAVQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLWVEERLPLATSQEHGHNLQTVQMLQKKHQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQQYLNDAEEAEA
WIGEQELYMISDETPKDEQSALLMLKRHLLLKQAVDDYSQPMRRLAARAQRLLAEDHPEG
ETIGRRQGQVEQQYAGLRELAEERRRKLDHTYQHHLLSREVEELEQWIAERDVAASSQEM
GHDLDQVTLLRDRFRDFARDTGVSGQERVDQVNETIDELISAGHSQASTLADWKDAVNES
WADLLELIDTRGQLLSASYELLKYFDDGKELVVQIHEKQKELPQDVGEDFGKAETFHRMH
AAFERDITSLDKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWRGLLAACDGRRAE
LVDTAEKYHFFTMVKDLLGWMEAVGQQIETQEKPRWDVSSVELLQKYHQGIRSEMEARGP
KFTDCMDLGRALLTRKHRDSAEIKEKLVLLMETRKEMMLRWDDRWDWLRLLLEVCQFSRD
ASVAEAWLIAQEPYVASREVGHSVNEVEKLLKRHEAFEKSTASWEERFCALERLTTMELL
ENSWSQRGREDTGFVEDSQLLTTERQTLDSTVLLLSESLRESGSMELDPSLSAAGPSAWE
PRAATMPSEGPRAPALLQEGTLGRKHDLEGPGKKASNRSWNSLYCVLKLGQLSVYKDSKS
FGHAVTFHGEDPLALDGAGWEPLANYKKKKHVFKLRLRDGGEYLFQCKDEXXXXRWGAAM
SQAALAQEGAEPADSSGAKAHSLPPAAL
Download sequence
Identical sequences ENSGMOP00000009549 ENSGMOP00000009549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]