SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009583 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009583
Domain Number 1 Region: 134-295
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.49e-39
Family Reductases 0.0000333
Further Details:      
 
Domain Number 2 Region: 32-149
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.74e-36
Family Ferredoxin reductase FAD-binding domain-like 0.00000384
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009583   Gene: ENSGMOG00000008967   Transcript: ENSGMOT00000009842
Sequence length 297
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2807:172786:176558:-1 gene:ENSGMOG00000008967 transcript:ENSGMOT00000009842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPVIAALSLVAVSVLYLLLEEPKKRKLLVTLQDATIKYPLRLIDKEEISHDTKKFRFGL
PSPTHILGLPIGQHVYLSAKVNGSLTVRAYTPVTSDEHQGYVDLVVKVYYKDSHPSFPAG
GKMSQYLDDMAVGDAIDFRGPSGLLVYNGNGKFSIRPDKKSEPKIKTFKHIAMIAGGTGI
TPMLQLIRSIAADHMDDTKCYLIFANQTEKDILLREELAEVKANHPDTLELWFTLDKPPK
DWSYSSGFVTSDMIKEHFPPASSDVLIVLCGPPPMIQYACLPNLEKLGYKTDNIFAY
Download sequence
Identical sequences ENSGMOP00000009583 ENSGMOP00000009583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]