SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009598 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009598
Domain Number 1 Region: 90-223
Classification Level Classification E-value
Superfamily EF-hand 1.23e-18
Family Calmodulin-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009598   Gene: ENSGMOG00000008966   Transcript: ENSGMOT00000009857
Sequence length 251
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4585:88376:96646:-1 gene:ENSGMOG00000008966 transcript:ENSGMOT00000009857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIVMASEELARKLQRRLDTEQGSAASAAAPTEEEVPAKCSEQPETPESERAATAGADDNN
AAASSELNAKLTRRLDINDGIAAPKRSKVFNPYTEFKEFSRKQIKDMEAMFKRFDSGKDG
FIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSYREFLLIFHKAAAGELEEESG
LMALARLSEIDVSTEGVMGAKDFFKQQMKALSVGSKFELEILEEKEERKKQEQDKKERRA
AFKELQSTFCS
Download sequence
Identical sequences ENSGMOP00000009598 ENSGMOP00000009598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]