SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009627 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000009627
Domain Number - Region: 30-106
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009627   Gene: ENSGMOG00000009019   Transcript: ENSGMOT00000009886
Sequence length 132
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4585:100073:102481:-1 gene:ENSGMOG00000009019 transcript:ENSGMOT00000009886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANDPLAEAGFHFDDLNKLRVLDPEVGQKTSELKEECKEFVDKIGQFQKIVGGLIELVDE
LAKEAETEKMKAIGARNLLKSVAKQRDAQQQQLQALIAEKTMQLERYRIEYEALSKVEAE
QNEFIDQFILQK
Download sequence
Identical sequences ENSGMOP00000009627 ENSGMOP00000009627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]