SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009655 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009655
Domain Number 1 Region: 194-312
Classification Level Classification E-value
Superfamily PH domain-like 8.97e-35
Family Pleckstrin-homology domain (PH domain) 0.00000826
Further Details:      
 
Domain Number 2 Region: 16-76
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.96e-20
Family Adapter protein APS, dimerisation domain 0.00018
Further Details:      
 
Domain Number 3 Region: 421-509
Classification Level Classification E-value
Superfamily SH2 domain 9.55e-17
Family SH2 domain 0.0000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009655   Gene: ENSGMOG00000009043   Transcript: ENSGMOT00000009915
Sequence length 516
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1885:69229:79523:1 gene:ENSGMOG00000009043 transcript:ENSGMOT00000009915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAGGSPDLSSCPLPDWREFCELHARASASDFAHKFQRFLTENPCYAAPGADLSFSQHF
TAHFLDCFSAALSQARESQAASPGEEGSGAPPNAARTPGPPXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXLLEVQRGALRYMVADDSGCVGGAAQWLKCRLLLRKTKREEERDKFYLEFY
VPPKSSKPKVSIPLSAIVEVRTTMPLEMPDKDNTFVLKVENGAEYILETIDSLQKNSWVA
DIQDCIDPGDSGDDIELASCPHGQTAKDCSMVASCSCELLSEGVYRPPERPCSAAAEPHS
APSVRCRESPFTQHPSHMPLERFLQSPEAQSXXXXXXXXXXXXXXXXXXXXXXXXXXXRA
AQLVLAGGARSHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSVNESGQCHVHHLWFHTV
SDMLRHFHAHPIPLESGGSADITLRSYVQVTRCPTA
Download sequence
Identical sequences ENSGMOP00000009655 ENSGMOP00000009655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]