SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009856 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000009856
Domain Number - Region: 6-95
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0637
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009856   Gene: ENSGMOG00000009206   Transcript: ENSGMOT00000010120
Sequence length 766
Comment pep:novel genescaffold:gadMor1:GeneScaffold_670:35106:45037:-1 gene:ENSGMOG00000009206 transcript:ENSGMOT00000010120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSKFLDDDFEVKDWVNGAFRVAQKEAPGKADAHAATLVMKLQLFIQEVNNAIEESSIQ
ALQNMPRVLRDVEALKQEASFLKEQMVLVKEDIRKFEQDTVQSMQVLVAIDQVKSRMQLS
AEALQEADKWSTLSADIEETFKTQDFAVISSKLTSMQGSLAMLVDTPDYSDKCVHLEALK
NRLEALASTQIVSTFNSMATDQAKLFVKVFSEMDRMPQLLAYYYKCHKGQLLSSWVELSQ
SELTVNQQLSEFYDNLLSAWHAQIHWTSQVFKKPYEVVTVLLIQTLGNMVPSVPVCVSSA
LERCDPEGRLEALLELHHTTSTFTHSLEAATLPHLGEANPMKLCELVCVLLEPYKSYQLQ
YGELEEVNLLIQISAVPLEHGEVMDCVQELSQSVAKLFSLAGGAVERCVRLSDGLAVRGL
LHALKALFTKYVSDFSTTLQSIRRKCKLEEMPTSSVFQEDWTAFQNSVRIIATCGELLRQ
FGAFEQQLSNKILGTAGKYLSESYSPRSLPAIQEVSSSDRKCIGSPWQEYNYLQKGNTAE
YNGVMELLYSLKEKATGASSLLAEPRAALTRLNQQANRLAFDSVFLQIKHQIHLVAPRDS
GDVGPGDRYTDDLPTFSLSPQEYISNIGQYIMSLPLHLEPFVTQEDPALELALHAGKLPF
PPEQGDDLPELDNTADYWLGSIARATMQTYCDAILQVPHLQPRATKQMITDIEYLSNVMD
ALGLQPSRSLQNILALLRSREDYRQTAKPLPRRMASTIAAIRGLDY
Download sequence
Identical sequences ENSGMOP00000009856 ENSGMOP00000009856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]