SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009906 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009906
Domain Number 1 Region: 968-1084
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-26
Family PDZ domain 0.0000998
Further Details:      
 
Domain Number 2 Region: 454-565
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-23
Family PDZ domain 0.0000296
Further Details:      
 
Domain Number 3 Region: 1131-1229
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-23
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 4 Region: 817-925
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-22
Family PDZ domain 0.00049
Further Details:      
 
Domain Number 5 Region: 639-737
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-20
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 6 Region: 129-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000236
Family Nucleotide and nucleoside kinases 0.0069
Further Details:      
 
Domain Number 7 Region: 310-347
Classification Level Classification E-value
Superfamily WW domain 0.00000000000208
Family WW domain 0.0011
Further Details:      
 
Domain Number 8 Region: 7-102
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000243
Family PDZ domain 0.034
Further Details:      
 
Domain Number 9 Region: 368-405
Classification Level Classification E-value
Superfamily WW domain 0.00000000057
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009906   Gene: ENSGMOG00000009267   Transcript: ENSGMOT00000010173
Sequence length 1250
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1681:648856:756390:-1 gene:ENSGMOG00000009267 transcript:ENSGMOT00000010173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPGIKKSHWTSRVRECALVKDARGELGVPLLGGANGEFATIGRLDQDVVVYHTGKLIE
GELLLEVENLSISGLPLYDLHTVIKNCKGPVRLKTVSQGNKLNKDLKHYLSLRFQKSSAD
HQLQQTIRENLYRHAVPCTTRPPRDEEVPGVHYNFLSVEDFLELEKAGTLLEIGSYEGNY
YGTPKPPAQPPAGIVISSGGDAPLADGLSGSLPGSQHSTPRRADTYDEMHHAGIGPGGRQ
HQHPLEDDEDLPEMNSSFTGDSSEADDFHQAVRPFDSRQSAPSYAGTTPSPLATTDRTQQ
THPHPPPEDDPLGPLPENWEMAYTENGEGYFIDHNTKTTSWIDPRCLDKPQKPLEECEDD
EGVHTEELDNDLELPTGWEKIDDPVYGVYYVDHINRKTQYENPVLEAKRRRQLEQQQWIE
DSNMAGAPLASYAAATQQETYRDPQKGPPVPNAMGQKRGKPFFTRNPAELKGTFINTKLK
KSRRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGYTHAQVV
KIFQSIGIGSMVNLELCRGYPLPFDPDDPNTSMVTSVAITENKEPIIVNGQESHNNYDSP
PSSHGSHGSNHLANNGGGGMALNGLPRPHSPSSASEAAGSEGQTLASSIATQPELITVHM
EKGDKGFGFTIADSPGGGGQRVKQIVDYPRCRGLKEGDIIVEVNKKNVQTMSHNQVVDLL
SKCPKGTEVTMLVQRGFPGVAPAKKSPKLXQLSRKDSQSSSQHSVSSQRSVHTQDSPLHS
SLAAPLSESSAPPAPSQPLPGLPAQDSPADDPSQRKPDPFKIWAKSRVMYESRLPDFQEQ
DIFLWRKDTGFGFRILGGNEAGEPIYIGHIVKYGAADEDGRLRSGDELTCVDGTAVVGKS
HQLVVQLMQQAAKQGHVNLTVRRKTSAYGKGEGDVPPSPASSHHSSTQAPSLTEGKRTPQ
GSQNSLNTVSSGSGSTSGIGPASLQPYDVEIQRGENEGFGFVIVSSVSRPEAGTTFAGNA
CVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNNCSITNKSHSDIVNLIKEAGNTVTLRI
IPGDESSNASLLTNAEKIATITTTHAPQQQAEASYRNTKPKQESYEFKAPQAPPPLPPAQ
DGEVYSVDLDRDNKGFGFSLRGGKEYNMDLYVLRLAEEGAAVRNGMMRVGDEILEINGES
TKGMKHARAIELIKSGGRRAHLLLQRGDGSVPEYGGSIYENIPFSPVFTP
Download sequence
Identical sequences ENSGMOP00000009906 ENSGMOP00000009906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]