SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009939 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009939
Domain Number 1 Region: 214-346
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-39
Family Third domain of FERM 0.00036
Further Details:      
 
Domain Number 2 Region: 872-1020
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-31
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 3 Region: 113-216
Classification Level Classification E-value
Superfamily Second domain of FERM 1.1e-24
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 4 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-24
Family First domain of FERM 0.0025
Further Details:      
 
Domain Number 5 Region: 615-745
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-21
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 6 Region: 777-851
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000009939
Domain Number - Region: 528-557
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00196
Family DBL homology domain (DH-domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009939   Gene: ENSGMOG00000009298   Transcript: ENSGMOT00000010207
Sequence length 1038
Comment pep:novel genescaffold:gadMor1:GeneScaffold_921:3:51941:1 gene:ENSGMOG00000009298 transcript:ENSGMOT00000010207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPRLGAPVTLGISTLDPGLRPPAMPAGRRVTVRVRMLDDSEELFDVSQRAPGKVLFDLV
CTHMNLIEGDYFGLEFQDHHKMTVWLDLIKPLMKQLRRPKHTVLRFVVKFYPPDPAQLLE
ELTRYLFALQLKQDLSAGRLTCNDSSSALMVSHVVQSEIGDFEGSQSRSHLLNNNYIPDQ
MALMDRIMEFHSKNTGQTPAESDYQLLEVARRLEMYGVRQHPAKDREGTQLSLAASHTGV
LVFQGHTRINAFNWSKVRKLSFKRKRFLIKLRADLNSSYQDTLEFLMGSRDCCKVFWKIC
VEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVIDYVKESXXXXXXXXXKHSRVQ
HVCRLSPVPSPRRQEVPSEESALVTAEDPAPSXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVVSGGPQPAASPGAPRP
HALLNGQKHSLDLCGLSPDGRQPSPLTSPLLYDAGCVRTDDEDEVRRKRFPNDRAYFIAK
ELLTTERTYLKDLEVVSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEGRSNAHIKGEYQHIGDVMLKNIQGLKPLTANLQRQAEALVDLDQACRSSRRLQDVC
RDFELQKVCYVPLNVFLLRPLHRLTHYKQILERFCKHYPPTHGDFRDCRAALADVTEVVE
QLRGSMLKMENFQKLLELKKDLIGIDNLVIPGRXXXXXXXXXXXXXXXXXXXXXXXFNDV
ILYTSRGMTATNQFKVHGQLPLHGMTIRESEDEWGVPNAFTLIGQQQSVVVAASSLSEME
KWMEDIKMAIDLAAETSNGPASDILSVDNKYPEDSSAEAESEDDLAAPRGPPEKPPPHRA
NTTVHVCWHRNTSVSMLDFSLAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKTHQ
DDYPLASLPLLGYSVTVPSEAENIHKDYVFKLHFKSHVYYFRSESEYTFERWMEVIRSAT
VPSSRTRIQNRKNETIPH
Download sequence
Identical sequences ENSGMOP00000009939 ENSGMOP00000009939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]